SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO14786
Annotation
endonuclease-reverse_transcriptase_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 2.294
 

Sequence

CDS
ATGAGAACCAATGTCTCCATCCTCGAAGAGCTGAAGGTCACCAAGCGCCTGCTGACTATGTGCCAGGAAAGGATCCGGAGTTTCTTTGGGCACATAATGCGATCCTCATTGCACAGCCTGGAGAAACTCACAATTCTCGGACAGATGGAGGGGAAGCGCGCTAGAGGAAGAGCGCCAGCTAGATGGGTTGACCAACTCAAGGAGGTGACTGGAGGCCAGATATGGGGAGCGGTACATATGGCGCAGAACCGGACCGAGTGGAGAAGATTGACATACAGTCACGATCCTCCTCAGCATTGA
Protein
MRTNVSILEELKVTKRLLTMCQERIRSFFGHIMRSSLHSLEKLTILGQMEGKRARGRAPARWVDQLKEVTGGQIWGAVHMAQNRTEWRRLTYSHDPPQH

Summary

Similarity
Belongs to the UDP-glycosyltransferase family.
EMBL
KZ150203    PZC72267.1    GU815090    ADF18553.1    FJ265559    ADI61827.1    + More
RSAL01000289    RVE42931.1    ODYU01004401    SOQ44236.1    FJ265548    ADI61816.1    KZ150366    PZC71172.1    ODYU01001007    SOQ36619.1    ODYU01003523    SOQ42419.1    FJ265546    ADI61814.1    GAIX01008594    JAA83966.1    FJ265547    ADI61815.1    FJ265560    ADI61828.1    ODYU01006805    SOQ48998.1    KQ459603    KPI92872.1    FJ265557    ADI61825.1    FJ265552    ADI61820.1    KZ150087    PZC73751.1    AAGJ04161766    BART01031562    GAH15691.1    KZ150088    PZC73730.1    LADJ01058192    KPJ21589.1    AAGJ04055194    LBMM01032604    KMQ81702.1    MRZV01000817    PIK43880.1    AFYH01119920    MRZV01000994    PIK41715.1    KQ459547    KPJ00048.1    MRZV01000940    PIK42365.1    MRZV01000378    PIK51329.1    MRZV01001207    PIK39730.1    MRZV01002322    PIK33998.1    MRZV01001216    PIK39650.1    MRZV01000056    PIK60437.1    MRZV01000196    PIK55924.1    AAGJ04154883    AGBW02010540    OWR48330.1    RQTK01000360    RUS81011.1    RQTK01000752    RUS75316.1    KL363266    KL367526    KFD49675.1    KFD66333.1    RQTK01001448    RUS70261.1    UZAH01026759    VDO85005.1    GDRN01098129    JAI59014.1    GU815089    ADF18552.1    GGMR01005851    MBY18470.1    UZAH01025466    VDO64497.1    NCKU01012182    RWS00163.1    GBHO01041897    JAG01707.1    NCKU01008836    RWS01655.1    AAGJ04055057    AHAT01022938    NCKU01004395    RWS06003.1    RQTK01001364    RUS70632.1    KZ150034    PZC74657.1    UZAH01001657    VDO19881.1    KQ977522    KYN02133.1    RQTK01000685    RUS76136.1    AAGJ04068581    AAGJ04021158    KL363256    KL367985    KFD50217.1    KFD59415.1    KZ150032    PZC74715.1    GDHC01017214    JAQ01415.1    NWSH01002736    PCG67606.1    AHAT01015554    RQTK01000625    RUS76894.1    ABLF02023718    AAGJ04128321    KZ353189    PIO61683.1    KZ150002    PZC75290.1    KFD49622.1    KFD66271.1   
Pfam
PF00078   RVT_1        + More
PF14529   Exo_endo_phos_2
PF05699   Dimer_Tnp_hAT
PF00201   UDPGT
PF00351   Biopterin_H
Interpro
IPR036691   Endo/exonu/phosph_ase_sf        + More
IPR000477   RT_dom       
IPR005135   Endo/exonuclease/phosphatase       
IPR008906   HATC_C_dom       
IPR027124   Swc5/CFDP2       
IPR002213   UDP_glucos_trans       
IPR035595   UDP_glycos_trans_CS       
IPR000637   HMGI/Y_DNA-bd_CS       
IPR019774   Aromatic-AA_hydroxylase_C       
IPR036951   ArAA_hydroxylase_sf       
IPR036329   Aro-AA_hydroxylase_C_sf       
IPR001273   ArAA_hydroxylase       
SUPFAM
SSF56219   SSF56219        + More
SSF56534   SSF56534       
Gene 3D

Ontologies

Topology

Length:
99
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.0014
Exp number, first 60 AAs:
0.0012
Total prob of N-in:
0.27104
outside
1  -  99
 
 

Population Genetic Test Statistics

Pi
193.274156
Theta
152.067946
Tajima's D
0.851874
CLR
0.266964
CSRT
0.618369081545923
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号