SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO14718
Pre Gene Modal
BGIBMGA013783
Annotation
AF461149_1_transposase_[Bombyx_mori]
Location in the cell
Nuclear   Reliability : 2.377
 

Sequence

CDS
ATGCCTCGGCGAGAGCCGACCGGTCGCGGGTCAAAGAAACCACGACCGAACCGCCGAGCTGTGCTCTGCCAAAAGCAGGGTCACACGGCCAACTACCGCGGATGCCCCAAGGCCCCGCGGAAGTGCCCGGCCAACGCGCGCCCCAAAACCGCCGGCTCTAAGACTTTTGAGTCCCGCGCGCCGAAACCTGCTTTCGTGGCGGCTCCGGTGCCCACCGTCTTCGCGTGGGCTAAACCGCTGCCGCTCACGATGGCAGAAGAAAGCTACAACAAAAAAATTGATAAGGTGTACGCACACAGTAATGAAGAAGCGAGCAACCGTATTCCGCGTGTCCAACGAGGTCATTTTCCATCCTCGCTCATGGTATGGTTGGGAGTTTCTTATTGGGGCTTAACAGAGGTACATTTTTGTGAGAAAGGTGTAAAAACGAATGCAGTTGTGTATCAAAATACAGTCCTGACGAACCTTGTGGTACCTGTTTCTCATACCATGTTCAATAACAGTCACTGGGTATTCCAACAAGATTCGGCGCCAGTTCATAGAGCGAAGAGCACACAAGACTGGCTGGCGGCGCGTGAAATCGACTTCATCCGGCACGAAGACTGGCCCTCCTCCAGTCCAGATTTGAATCCGTTAGATTACAAGATATGGCAATACTTGAGGAAAAGGCGTGCTCAAAGCCTCATCCCAATTTGGAGTCACTCAAGACATCCTTGA
Protein
MPRREPTGRGSKKPRPNRRAVLCQKQGHTANYRGCPKAPRKCPANARPKTAGSKTFESRAPKPAFVAAPVPTVFAWAKPLPLTMAEESYNKKIDKVYAHSNEEASNRIPRVQRGHFPSSLMVWLGVSYWGLTEVHFCEKGVKTNAVVYQNTVLTNLVVPVSHTMFNNSHWVFQQDSAPVHRAKSTQDWLAAREIDFIRHEDWPSSSPDLNPLDYKIWQYLRKRRAQSLIPIWSHSRHP

Summary

Uniprot
ProteinModelPortal
PDB
5CR4     E-value=8.59347e-07,     Score=124

Ontologies

GO

Topology

Length:
238
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.3119
Exp number, first 60 AAs:
0.00066
Total prob of N-in:
0.07979
outside
1  -  238
 
 

Population Genetic Test Statistics

Pi
409.95342
Theta
204.139413
Tajima's D
4.933458
CLR
0.178104
CSRT
0.999950002499875
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号