SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO14641
Annotation
reverse_transcriptase_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 1.561
 

Sequence

CDS
ATGGCCCTATACGGGGCGCCTGTGTGGGGCCAGTCCCTGGCCGTGGGGGTGGCGAAGCTGCTGCAACTGCCGCAACGCACCATCGCGGTCAGGGTCATCCGTGGTTATCGCACCATCTCCTTTGAGGCGGCGTATGTTCTGGCTGGGACGCCGCCTTGGGTTCTGGAAGCGGAGGCGCTCGCCGCTGACTATCAGTGGCGGGCTGAACTTCGCGCCCGGGGCGTGGCGCGTCCCAGCCACAGTGTGGTCAGAGCGCGGAGGGCCCAATCTCGGCGGTCCGTGCTGGAGTCATGGTCCAGACGGCTGGCTGATCCTTCGGCTGGTCGTAGGACCGTCGAGGCGATTCGCCCGGTCCTTGTGGATTGGGTGAATCGTGACAGAGGACACCTCACTTTCCGGCTCACGCAGGTGCTCACTGGGCATGGTTGCTTCGGTGAGTTCCTGCACCGGATCAGAGCCGAGCCGACGGCAGAGTGCCACCATTGTGATTGCGACTTGGAAACGGCAGAGCATACGCTCGTCGCCTGCCCCGCATGGGAGGGGTGGCGCCGTGTCCTCGTCGCAAAAGTAGGAAACGACTTGTCGTTGCCGAGTGTTGTGGCATCGATGCTCGGCGACGACGAGTCGCGGAAGGCGATGCTCGACTTCTGCGAGTGCACCATCTCGTCGGTCTGGCGACCGGCGAGGGGGGCCTAA
Protein
MALYGAPVWGQSLAVGVAKLLQLPQRTIAVRVIRGYRTISFEAAYVLAGTPPWVLEAEALAADYQWRAELRARGVARPSHSVVRARRAQSRRSVLESWSRRLADPSAGRRTVEAIRPVLVDWVNRDRGHLTFRLTQVLTGHGCFGEFLHRIRAEPTAECHHCDCDLETAEHTLVACPAWEGWRRVLVAKVGNDLSLPSVVASMLGDDESRKAMLDFCECTISSVWRPARGA

Summary

Cofactor
FAD
Similarity
Belongs to the GMC oxidoreductase family.
EMBL
AB126050    BAD86650.1    AB090825    BAC57926.1    KZ150386    PZC71062.1    + More
LBMM01009501    KMQ88083.1    KZ149950    PZC76665.1    AB078935    BAC06462.1    AB078930    BAC06454.1    AB078931    BAC06456.1    KZ150308    PZC71477.1    AB078929    BAC06452.1    KZ149896    PZC78733.1    LBMM01012027    KMQ86470.1    LBMM01006538    KMQ90523.1    LBMM01012957    LBMM01012956    KMQ85900.1    KMQ85901.1    D85594    BAA19776.1    ODYU01009945    SOQ54696.1    RSAL01000481    RVE41577.1    LBMM01008861    KMQ88580.1    LBMM01016102    KMQ84557.1    KQ460685    KPJ12887.1    QOIP01000009    RLU18544.1    LBMM01003679    KMQ93242.1    LBMM01014132    KMQ85305.1    LBMM01009494    KMQ88097.1    LBMM01024024    KMQ82631.1    LBMM01006909    KMQ90209.1    GL450953    EFN80213.1    RSAL01000109    RVE47213.1    LBMM01005733    KMQ91252.1    LBMM01006954    KMQ90166.1    LBMM01006110    KMQ90925.1    QOIP01000010    RLU18098.1    LBMM01006657    KMQ90417.1    LBMM01008682    KMQ88705.1    LBMM01006671    KMQ90407.1    RSAL01003504    RVE40273.1    QOIP01000031    RLU14697.1    LBMM01019838    KMQ83439.1    LBMM01019839    KMQ83438.1    KQ414641    KOC66782.1    LBMM01005634    KMQ91349.1    LBMM01004272    KMQ92618.1    QOIP01000007    RLU20280.1    LBMM01006063    KMQ90967.1    ODYU01005282    SOQ45985.1    LBMM01009738    KMQ87908.1    LBMM01007036    KMQ90099.1    LBMM01006662    KMQ90413.1    ABLF02026677    ABLF02032994    ABLF02059021    ABLF02064578    CH963857    KRF98317.1    LBMM01002052    KMQ95336.1    GL437417    EFN70484.1    ABLF02037241    ABLF02037246    ABLF02044766    GGMR01006442    MBY19061.1    LBMM01015018    KMQ84954.1    GGMR01016864    MBY29483.1    LBMM01011877    KMQ86578.1    LBMM01006725    KMQ90373.1    LBMM01004634    KMQ92224.1    LBMM01014909    KMQ85000.1    LBMM01006640    KMQ90440.1    LBMM01004505    KMQ92346.1    LBMM01015025    KMQ84953.1    LBMM01012595    KMQ86127.1    GGMS01002352    MBY71555.1    ODYU01000330    SOQ34889.1    LBMM01021647    KMQ83033.1    GGMR01019609    MBY32228.1    LBMM01007425    KMQ89740.1    LBMM01008349    KMQ88951.1    ABLF02016435    ABLF02016436    ABLF02064751    ABLF02006132    ABLF02041886    LBMM01005216    KMQ91703.1    LBMM01014294    KMQ85237.1    LBMM01002480    KMQ94776.1    ABLF02005203    ABLF02041316    ABLF02023401    ABLF02029423    ABLF02060278   
Pfam
PF14529   Exo_endo_phos_2        + More
PF00078   RVT_1
PF01553   Acyltransferase
PF03372   Exo_endo_phos
PF07776   zf-AD
PF00096   zf-C2H2
PF01421   Reprolysin
PF00732   GMC_oxred_N
PF17919   RT_RNaseH_2
PF05721   PhyH
PF13843   DDE_Tnp_1_7
PF05699   Dimer_Tnp_hAT
Interpro
IPR000477   RT_dom        + More
IPR036691   Endo/exonu/phosph_ase_sf       
IPR005135   Endo/exonuclease/phosphatase       
IPR002123   Plipid/glycerol_acylTrfase       
IPR012934   Znf_AD       
IPR013087   Znf_C2H2_type       
IPR036236   Znf_C2H2_sf       
IPR024079   MetalloPept_cat_dom_sf       
IPR001590   Peptidase_M12B       
IPR001878   Znf_CCHC       
IPR036875   Znf_CCHC_sf       
IPR036188   FAD/NAD-bd_sf       
IPR012132   GMC_OxRdtase       
IPR000172   GMC_OxRdtase_N       
IPR041577   RT_RNaseH_2       
IPR008775   Phytyl_CoA_dOase       
IPR029526   PGBD       
IPR037220   BED_dom       
IPR012337   RNaseH-like_sf       
IPR008906   HATC_C_dom       
SUPFAM
SSF56219   SSF56219        + More
SSF57667   SSF57667       
SSF57756   SSF57756       
SSF51905   SSF51905       
SSF53098   SSF53098       
SSF140996   SSF140996       
Gene 3D

Ontologies

Topology

Length:
231
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.13386
Exp number, first 60 AAs:
0.13177
Total prob of N-in:
0.02115
outside
1  -  231
 
 

Population Genetic Test Statistics

Pi
64.46323
Theta
40.142035
Tajima's D
3.40256
CLR
0.140656
CSRT
0.992950352482376
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号