SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO14633  Validated by peptides from experiments
Pre Gene Modal
BGIBMGA009563
Annotation
PREDICTED:_metal_transporter_CNNM4-like_[Amyelois_transitella]
Location in the cell
Cytoplasmic   Reliability : 2.127
 

Sequence

CDS
ATGGCGTTGGACCGCACCGAATTGAAGATCATCGCGAACACGGGCACAGAGAAAGAGAGGAAGTACGCGAGAGCCATTATGCCGGTCAGGGCCCACGGGAACTATCTCCTCTGCACGATCCTGCTCAGTAACGTGGCCGTGAACAGCACATTTACGGTCATCCTGGACGATCTGACGTCTGGGCTGGTGGCGGTCATCGGTTCGACCTTGGCGATCGTGTTCATAGCCGAGATAACGCCGCAAGCCATCTGCGCTAGACACGGCCTGCTGATCGGAGCGAAGAGTATCTGGATCATGAAGATCGTCATGGGTATCTGCGCTCCACTCGCCTGGCCGACCAGCAAACTCCTGGACTACTTCCTGGGCGAAGAAATCGGCACTCATTACAACAGGGAAAGACTAAAGGAACTAGTCAGGGTCACGAACCACGTTAACGATTTGGACAAAGAGGAGGTGAACATCATCTCCGGCGCCCTGGATCTTCGCAAGAAGACCGTCAAAGACGTGATGACGAAGCTCAAGGACTGCTTCATGCTGCCGATCAATAGCGTCCTAGACTTCGAGACCATGTCCGAAATCGTCAAATCTGGCTACTCCCGCATCCCGGTGTACGAGGGTCACCGCGGGAACATCGTGACGGTGCTCTTCATCAAGGACCTCGCCTTTGTCGACCCCGATGACAACACGCCTCTGAGGACCCTCTGCCAGTACTACCAGAACCCTTGCAACTTCGTCTTCGAAGACGTCACCTTGGATGTCATGCTGAAGCAGTTCAAAGAAGGGCACAAAGGTCACATGGCGTTCGTTCAGCGCATCGAGGAAGGCGATGGGGATCCCATATACGAGACAGTAGGCCTACTGACTTTGGAAGACGTCATCGAGGAGATGATCCAAGCAGAGATCGTGGATGAGACCGATGTCTTTAGCGACAACCGCACCAAGAAGCGCTTGACCCGGCCAGTCAACAAGTTCCAAGATATAGGAGCTTTCATGGGTCACCAGGAGCACCAGCGCGTCCACGTATCCCCGCAGCAGGTGCTAGCCACCTTCCAGTTCTTGAGCACGAGCGTGGACCCATTCCGTCCTGAGATGATCTCAGAGACAGTTCTCCGTCGACTGCTGAAGCAAGACGTCATACAGCACATCAAGCTGAAGGGAGATGAGGATAAGAACGACATCAAACGCTTCGTTTATCAGGAGGGGAAGCCGGTGGATTATTTCGTGTTGATCCTGGAAGGTCGCGTGGAGGTCACCGTCGGAAGGGAGAACCTGGTTTTCGAAGCTGGACCCTTCACGTACTTCGGAGTGCAAGCTCTGACCCAGAACGTGGGACTAGCGGAGGCTCCTGCACCATCGACCCTCGGCTCCCTGCAGAACCTCAACATGGACTCGATGCTGCGCCACACCTTCGTACCTGACTACTCAGTCAAGGCCATCGCTGAACTATACTACCTCACCATCAAACGGTCAATGTACTTAGCGGCTAAACGCGCCACGCTCATGGAGAAGGGGGTGCTCAACAAGGGCGGCACTAATGAGCAGATCGAACCAGAAGTGGATAAGTTACTTCGCGAAGGCGACAGGATCGAGGAGGTCCGGGAGAACGAGGAGTCGCCCAAATCACAGTTCGTACCCTCATCGGCGAGTCCTCGCACCAACTCGACCTTCAAGTCTCTCCTCGACAAAGAAGCAGCTGAAGAGGAAGAAAAACTACTAAAAAAGTAG
Protein
MALDRTELKIIANTGTEKERKYARAIMPVRAHGNYLLCTILLSNVAVNSTFTVILDDLTSGLVAVIGSTLAIVFIAEITPQAICARHGLLIGAKSIWIMKIVMGICAPLAWPTSKLLDYFLGEEIGTHYNRERLKELVRVTNHVNDLDKEEVNIISGALDLRKKTVKDVMTKLKDCFMLPINSVLDFETMSEIVKSGYSRIPVYEGHRGNIVTVLFIKDLAFVDPDDNTPLRTLCQYYQNPCNFVFEDVTLDVMLKQFKEGHKGHMAFVQRIEEGDGDPIYETVGLLTLEDVIEEMIQAEIVDETDVFSDNRTKKRLTRPVNKFQDIGAFMGHQEHQRVHVSPQQVLATFQFLSTSVDPFRPEMISETVLRRLLKQDVIQHIKLKGDEDKNDIKRFVYQEGKPVDYFVLILEGRVEVTVGRENLVFEAGPFTYFGVQALTQNVGLAEAPAPSTLGSLQNLNMDSMLRHTFVPDYSVKAIAELYYLTIKRSMYLAAKRATLMEKGVLNKGGTNEQIEPEVDKLLREGDRIEEVRENEESPKSQFVPSSASPRTNSTFKSLLDKEAAEEEEKLLKK

Summary

EMBL
BABH01040476    BABH01040477    NWSH01000720    PCG74629.1    ODYU01003035    SOQ41307.1    + More
RSAL01000199    RVE44514.1    KQ459249    KPJ02289.1    NWSH01000060    PCG80066.1    BABH01037749    BABH01037750    KQ460301    KPJ16123.1    GAIX01010073    JAA82487.1    KPJ16143.1    KQ435710    KOX79812.1    QOIP01000001    RLU26364.1    KK107159    EZA56684.1    KQ414940    KOC59188.1    KQ777939    OAD52039.1    KQ981940    KYN32677.1    GL439921    EFN66596.1    KQ980079    KYN17809.1    GL447495    EFN86431.1    KZ288287    PBC29416.1    KQ978231    KYM96089.1    KQ976529    KYM81791.1    ADTU01027491    ADTU01027492    KQ982850    KYQ49943.1    GFDF01009584    JAV04500.1    GL888334    EGI62522.1    KQ434892    KZC10512.1    GL768163    EFZ11891.1    GECZ01000402    JAS69367.1    GECZ01013304    JAS56465.1    KPJ02267.1    NNAY01000444    OXU28342.1    GECZ01023653    JAS46116.1    GECZ01020191    JAS49578.1    GEDC01009880    JAS27418.1    NEVH01001355    PNF42861.1    GAPW01000183    JAC13415.1    JXUM01089765    KQ563796    KXJ73288.1    GEZM01102946    JAV51687.1    GEDC01009151    JAS28147.1    CH478182    EAT33657.1    ODYU01000032    SOQ34117.1    GEZM01102945    JAV51688.1    GEZM01102944    JAV51689.1    GFXV01004124    MBW15929.1    GGMR01008607    MBY21226.1    KK853149    KDR10673.1    ABLF02030588    ABLF02030600    ABLF02030602    ABLF02030604    GFDL01001745    JAV33300.1    GFDL01001739    JAV33306.1    KQ971312    EEZ98477.1    KB631924    ERL87181.1    APGK01044408    APGK01044409    APGK01044410    APGK01044411    KB741026    ENN74893.1    CVRI01000048    CRK98833.1    CH964289    KRG00341.1    KA647782    AFP62411.1    CH940649    KRF81674.1    GEBQ01025213    JAT14764.1    JRES01001511    KNC22356.1    KK857470    PTY27200.1    CH933807    KRG03803.1    LJIG01009686    KRT82583.1    ACPB03006135    CH954177    KQS71083.1    AE013599    AIG63332.1    EDP28148.2    EDP28149.2    ELP57407.1    CH902628    KPU75331.1    CH891640    KRK05075.1    KRK05076.1    KRK05077.1    GGFM01002893    MBW23644.1    GGFJ01001207    MBW50348.1    GGFJ01001304    MBW50445.1    GGFJ01001300    MBW50441.1    CP012523    ALC39157.1    GGFM01002384    MBW23135.1    GGFK01004617    MBW37938.1    GGFM01006966    MBW27717.1    GGFK01004914    MBW38235.1    ADMH02001227    ETN63585.1    OUUW01000010    SPP85574.1    GGFK01004694    MBW38015.1    GAMC01017159    JAB89396.1    GDHF01005181    JAI47133.1    GAKP01008896    JAC50056.1    GBHO01039187    GDHC01007994    JAG04417.1    JAQ10635.1    GBXI01010406    JAD03886.1    GDHC01022009    JAP96619.1    GBHO01039189    JAG04415.1    GDHC01009380    JAQ09249.1   
Pfam
PF01595   DUF21        + More
PF00400   WD40
PF08799   PRP4
PF00571   CBS
PF00027   cNMP_binding
Interpro
IPR000595   cNMP-bd_dom        + More
IPR014710   RmlC-like_jellyroll       
IPR000644   CBS_dom       
IPR018490   cNMP-bd-like       
IPR002550   CNNM       
IPR001680   WD40_repeat       
IPR014906   PRP4-like       
IPR017986   WD40_repeat_dom       
IPR015943   WD40/YVTN_repeat-like_dom_sf       
IPR036322   WD40_repeat_dom_sf       
IPR019775   WD40_repeat_CS       
IPR036285   PRP4-like_sf       
IPR020472   G-protein_beta_WD-40_rep       
SUPFAM
SSF51206   SSF51206        + More
SSF50978   SSF50978       
SSF158230   SSF158230       
Gene 3D
PDB
4IY0     E-value=3.14444e-53,     Score=529

Ontologies

Topology

Length:
574
Number of predicted TMHs:
3
Exp number of AAs in TMHs:
64.5794100000002
Exp number, first 60 AAs:
24.50696
Total prob of N-in:
0.99336
POSSIBLE N-term signal
sequence
inside
1  -  32
TMhelix
33  -  55
outside
56  -  58
TMhelix
59  -  76
inside
77  -  88
TMhelix
89  -  111
outside
112  -  574
 
 

Population Genetic Test Statistics

Pi
269.947911
Theta
148.229761
Tajima's D
2.579261
CLR
0.349446
CSRT
0.955002249887506
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Peptides ×
Source Sequence Identity Evalue
31250652 VHVSPQQVLATFQFLSTTEAPAPSTLGSLQNLNMDSMLR 100.00 8e-09
26280517 FPIEIDCSIK 100.00 1e-05
28467696 FQCTITGSPR 100.00 1e-05
28556443 GGTNEQIEPEVDK 100.00 1e-05
28556443 VEVTVGR 100.00 0.001
28556443 VTGWDAPFPHVFEPF 100.00 0.001
26822097 IVDDMVPSVIR 100.00 0.024
28556443 IVDDMVPSVLR 100.00 0.024
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号