SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO14561
Pre Gene Modal
BGIBMGA003903
Annotation
PREDICTED:_uncharacterized_protein_LOC101745617_[Bombyx_mori]
Location in the cell
Nuclear   Reliability : 3.68
 

Sequence

CDS
ATGGCACGGAAGAAGACAGACAGAAAAATAGGGAATAGTTCCCATGTAAAAATTAAAGAAGGCTTGCAGTTTATAAGGAGCGGAGAATCTATAAGAAAGGCATCAAAAAGAGTTAATGTACTTTTTGCTACGCTTAAAAGGTATTATTGGAAGACCAAGAACTGAAATGTTGCAGACACCACGCCTATTCTTGACACTCTATCATGTCGTGACACTCCACCACGTCGTTCTGGGTCCCGGCAGACTGGCTGTGGTGCAGCCTCCTTAGGAGGAGGGAATGTGCGCACCAGGGTAATACAGGAAGAATTTAAGTTTAGAGAAGAATCTTATGAAAAGAAAGAGAGAAGAGAAGATGAACTCTTTCAATTACAAAAAAAGGAAAGAGAGTGGATGATGATGGCAGCAGAAGAAGTCTATCTAAAAGCAAAGGCTGAGAGGGAAGCTACAGAGGATCTTAAAAAATATAATCGGGCTAAAAGAGACTGTAGTGAAAAATAA
Protein
MARKKTDRKIGNSSHVKIKEGLQFIRSGESIRKASKRVNVLFATLKRYYWKTKNXNVADTTPILDTLSCRDTPPRRSGSRQTGCGAASLGGGNVRTRVIQEEFKFREESYEKKERREDELFQLQKKEREWMMMAAEEVYLKAKAEREATEDLKKYNRAKRDCSEK

Summary

Uniprot
ProteinModelPortal

Ontologies

GO

Topology

Length:
165
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.0005
Exp number, first 60 AAs:
0
Total prob of N-in:
0.76383
inside
1  -  165
 
 

Population Genetic Test Statistics

Pi
244.584725
Theta
165.201297
Tajima's D
0.887727
CLR
0.155423
CSRT
0.627268636568172
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号