SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO14548
Annotation
retrotransposon_protein?_putative?_Ty1-copia_subclass_[Oryza_sativa_Japonica_Group]
Location in the cell
Nuclear   Reliability : 2.065
 

Sequence

CDS
ATGTTTACGTCAGAAAATAATGACGACTATGACTGCTCTTTATTAACATACAAAGAAGCTGTGACTGGCATCGACAGACGAAATTGGGAGAAGGCGATACTATCTGAATTATACGGAGAGTTATCAGATGAAGTTTATATGAAATTGCCTGTTGGCTATGAGACTAACTGCAATACTAGTGAAGTAGTTTGGCGATTAAAAAAATCTTTGTACGGATTAAAACAAGCTCCATTTACATGGAACAAAACTTTTACCCAAGCGATGTTTGATTTGGGATTCAAGACAATCAAAACAGATCGATGCGTTTTCATAAACGAAGATAAGTCAATAATAATCGGACTATTCGTTGATGATGGACTTGTCATAGGAAAAGATAAGAAAAAGATCGAAGTTATTTTGAAGAAACTTGAAACCAAATTCCAAATGAAAAAGAATGAAAATCCAAGTACTTATCTGGGTATGGAAATAAAAAACTCAAAAGAAGGAATAATTCTTACTCAGAGATCCTACATAAATGACGTACTGGAAAAATACAACATGAAAAATGCCAAACCTTGTGACACACCCGCAAGTAGCGATTCAAAATCGATACAGGAAACTGCCCAGGAGAAGGAATATCCCTATTGGGAAGCAGTGGGAAGTTTACTGTACCTGTCTACTGGAGACCCATTGACGCGAAGAAGCACTTCTGGTTCCGTGCTAATGATAGCCGATGGACCAATATCATGGGCATCCAAGAGGCAGCCTATAGTAGCGCTATCGTCGACTGAAGCCGAGTACATAGCCGCAGCAGACTGTTGCAAAGAGGCATTGTATCTCAAATCTCTATTACAGGAAATAATCGATTTGGACATAAAAATAAATCTGTATGTTGATAACCAAAATTCGATTCAACTTGTGAAGTCTGGATCCTTCAACAAAAGGTCGAAGCACACAGACGTGCGGTACCATTTTATACATGAACACTTCGTGCATGGATTAATAAATATTAGCTACTGTCCAACAGAAATTCAGTTAGCTGACGTAATGACAAAACCATTGTCAAAAGTAAAATTTGAAAGACACTGTGCAAGATTAATGCATGTATAG
Protein
MFTSENNDDYDCSLLTYKEAVTGIDRRNWEKAILSELYGELSDEVYMKLPVGYETNCNTSEVVWRLKKSLYGLKQAPFTWNKTFTQAMFDLGFKTIKTDRCVFINEDKSIIIGLFVDDGLVIGKDKKKIEVILKKLETKFQMKKNENPSTYLGMEIKNSKEGIILTQRSYINDVLEKYNMKNAKPCDTPASSDSKSIQETAQEKEYPYWEAVGSLLYLSTGDPLTRRSTSGSVLMIADGPISWASKRQPIVALSSTEAEYIAAADCCKEALYLKSLLQEIIDLDIKINLYVDNQNSIQLVKSGSFNKRSKHTDVRYHFIHEHFVHGLINISYCPTEIQLADVMTKPLSKVKFERHCARLMHV

Summary

Similarity
Belongs to the glutamine synthetase family.
EMBL
GECL01003258    JAP02866.1    GBHO01012744    JAG30860.1    OIVN01000958    SPC87933.1    + More
FQNC01000011    SGY11774.1    GBHO01005715    JAG37889.1    GBHO01035865    JAG07739.1    GBHO01006096    JAG37508.1    GBHO01035869    GBHO01006095    JAG07735.1    JAG37509.1    OIVN01000521    SPC81512.1    OIVN01000602    SPC82810.1    OIVN01001657    SPC96321.1    OIVN01002113    SPD00719.1    OIVN01001697    SPC96741.1    DP000086    AAP54315.2    OIVN01002193    SPD01396.1    KQ971352    KYB26731.1    OIVN01005649    SPD23443.1    OIVN01000516    SPC81470.1    DF973549    GAU34203.1    OIVN01006170    SPD26869.1    AM447550    CAN76465.1    OIVN01000094    SPC74162.1    FQNC01000043    SGY49801.1    OIVN01001921    SPC98945.1    OIVN01000205    SPC76213.1    ASHM01049742    PNX85850.1    OIVN01000373    SPC79206.1    DS568046    ASHM01014005    PNX95963.1    AWWV01012043    OMO69325.1    PKPP01015627    PWA38442.1    OIVN01003344    SPD10596.1    AM483321    CAN73074.1    AM424437    CAN71185.1    AM476015    CAN61929.1    OIVN01001521    SPC94885.1    FN595231    CCB46625.1    AM424035    CAN82064.1    AL607003    CAE04585.2    LHPF02000053    PSC67594.1    OIVN01001372    SPC93219.1    SPC98939.1    OIVN01000106    SPC74382.1    OIVN01001193    SPC90993.1    AM453024    CAN61179.1    AF464738    AAL66758.1    AM441680    CAN65095.1    OIVN01000404    SPC79669.1    BEGY01000129    GAX84605.1    DF974410    GAU48356.1    AM453670    CAN76680.1    AM470056    CAN74984.1    OIVN01003190    SPD09397.1    OIVN01001946    SPC99200.1    AM431410    CAN64765.1    OIVN01001636    SPC96106.1    OIVN01006120    SPD25513.1    KQ483979    KYP38661.1    OIVN01004802    SPD19362.1    OIVN01003498    SPD11675.1    OIVN01004974    SPD20223.1    CM001883    EOY07906.1    CM001880    EOY01263.1    AM474616    CAN79422.1    AAZX01004352    AM450406    CAN74286.1    OIVN01005884    SPD24356.1    OIVN01001305    SPC92424.1    OIVN01003586    SPD12279.1    DP000009    ABF97186.1    OIVN01000025    SPC72824.1    AM484658    CAN64296.1    OIVN01003993    SPD14796.1    CM007900    OTG09093.1    OIVN01003546    SPD11986.1    DS264776    EDN05271.1    AC123594    AAM74419.1    CAFZ01000285    CCA74168.1    OIVN01006197    SPD27565.1    OIVN01003535    SPD11919.1    AWWV01015515    OMO52435.1    ASHM01035291    PNX79093.1    OIVN01005946    SPD24590.1    AC079853    AAK52561.1    ABF96427.1    CM003609    KYP64927.1    OIVN01000189    SPC75922.1    OIVN01001902    SPC98810.1    OIVN01000403    SPC79652.1    CR855107    CR855109    CAH66492.1    CAH66516.1    FMWP01000060    SCZ95056.1    AM478498    CAN66243.1    AM423491    CAN71132.1    DF973180    GAU18207.1    OIVN01000303    SPC77971.1    OIVN01006336    SPD30852.1    OIVN01006472    SPD33779.1    OIVN01000195    SPC76035.1    AB458444    BAH79981.1   
Pfam
PF13976   gag_pre-integrs        + More
PF07727   RVT_2
PF00665   rve
PF00098   zf-CCHC
PF00078   RVT_1
PF14244   Retrotran_gag_3
PF05699   Dimer_Tnp_hAT
PF13087   AAA_12
PF13456   RVT_3
PF00636   Ribonuclease_3
PF02170   PAZ
PF00271   Helicase_C
PF03368   Dicer_dimer
PF03732   Retrotrans_gag
PF00120   Gln-synt_C
PF13961   DUF4219
PF03094   Mlo
PF04434   SWIM
PF00069   Pkinase
Interpro
IPR025724   GAG-pre-integrase_dom        + More
IPR036397   RNaseH_sf       
IPR001584   Integrase_cat-core       
IPR039537   Retrotran_Ty1/copia-like       
IPR013103   RVT_2       
IPR012337   RNaseH-like_sf       
IPR036875   Znf_CCHC_sf       
IPR001878   Znf_CCHC       
IPR000477   RT_dom       
IPR029472   Copia-like_N       
IPR008906   HATC_C_dom       
IPR003656   Znf_BED       
IPR041679   DNA2/NAM7-like_AAA       
IPR027417   P-loop_NTPase       
IPR002156   RNaseH_domain       
IPR003100   PAZ_dom       
IPR000999   RNase_III_dom       
IPR038248   Dicer_dimer_sf       
IPR036085   PAZ_dom_sf       
IPR005034   Dicer_dimerisation_dom       
IPR036389   RNase_III_sf       
IPR014720   dsRBD_dom       
IPR001650   Helicase_C       
IPR005162   Retrotrans_gag_dom       
IPR014746   Gln_synth/guanido_kin_cat_dom       
IPR008146   Gln_synth_cat_dom       
IPR025314   DUF4219       
IPR004326   Mlo       
IPR036691   Endo/exonu/phosph_ase_sf       
IPR006564   Znf_PMZ       
IPR007527   Znf_SWIM       
IPR000719   Prot_kinase_dom       
IPR008266   Tyr_kinase_AS       
IPR011009   Kinase-like_dom_sf       
SUPFAM
SSF53098   SSF53098        + More
SSF57756   SSF57756       
SSF52540   SSF52540       
SSF101690   SSF101690       
SSF69065   SSF69065       
SSF55931   SSF55931       
SSF56219   SSF56219       
SSF56112   SSF56112       

Ontologies

Topology

Length:
362
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00844
Exp number, first 60 AAs:
0
Total prob of N-in:
0.02555
outside
1  -  362
 
 

Population Genetic Test Statistics

Pi
286.885449
Theta
185.624636
Tajima's D
1.887934
CLR
0
CSRT
0.866656667166642
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号