SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO14512
Pre Gene Modal
BGIBMGA009853
Annotation
PREDICTED:_uncharacterized_protein_LOC105843021_[Bombyx_mori]
Location in the cell
Nuclear   Reliability : 3.945
 

Sequence

CDS
ATGAGAACTAGCCACTCACAGTATTTAACAATGGTGGAATTTATGGAAGCTCAATATTTATGTAATGTGCCATACAATTTATATTCCAGAAATAGAGATTTATCAAAACCATCAGGCGGTCCACGAGGTCGCAATTTTATACAGATGAAGTGGAAAGAGTTAACGGAAATATTAAATAGCGATTCTTCAGGAGATCCTAAGAGTGAGGACAAATGGCGTAAGGTGTGGAGTGATTATAAGAATAATTGCAAGAAAAAGTGTGCTAAAACTGGCACTGGTGGCGGACCAGCGCTCCATCTATTATTAACTGACCAAGAACAAAGACTCATGCAGATAATTGGAGTGCAGGCAGCTACTGGCATGGAGCTAAAAGAAGCTGGGTTTCCACAAGAAGAAATTTCAACTGAGAGGCCAAATACTGAAATTATTTTAAAGGGACCGGAAATAGATTGGAATACTCCTAGCACAAGCAGCCAACCAACAGTGGCTCCACCGGCATCAACTGTGGCTTCCCCTCCAGTCATTAACGAGGAAGAGGAGTGTAACCCTCCGCCACAGAAAAAAAGAAAAAGCAATTTGACAAAAATGTTTTTAGATATACAACAGAAAGGCAAGGGAGTATGCTTCAGAGCGTGA
Protein
MRTSHSQYLTMVEFMEAQYLCNVPYNLYSRNRDLSKPSGGPRGRNFIQMKWKELTEILNSDSSGDPKSEDKWRKVWSDYKNNCKKKCAKTGTGGGPALHLLLTDQEQRLMQIIGVQAATGMELKEAGFPQEEISTERPNTEIILKGPEIDWNTPSTSSQPTVAPPASTVASPPVINEEEECNPPPQKKRKSNLTKMFLDIQQKGKGVCFRA

Summary

Pfam
PF13873   Myb_DNA-bind_5        + More
PF00096   zf-C2H2
Interpro
IPR028002   Myb_DNA-bind_5        + More
IPR026753   NAIF1       
IPR013087   Znf_C2H2_type       
IPR036236   Znf_C2H2_sf       
SUPFAM
SSF57667   SSF57667       

Ontologies

Topology

Length:
211
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00798
Exp number, first 60 AAs:
0.00732
Total prob of N-in:
0.20653
outside
1  -  211
 
 

Population Genetic Test Statistics

Pi
322.49134
Theta
193.592093
Tajima's D
2.044254
CLR
0.020351
CSRT
0.888005599720014
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号