SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO14511
Annotation
Putative_115_kDa_protein_in_type-1_retrotransposable_element_R1DM-like_Protein_[Tribolium_castaneum]
Location in the cell
Cytoplasmic   Reliability : 1.689 Mitochondrial   Reliability : 1.554 Nuclear   Reliability : 1.382
 

Sequence

CDS
ATGAGAGAAGAAGAAATATCTCGTACGAAGACAGAATGGGCACAAGACTGGCAGAAGAAGGGAAAAAGTACGTGGACCCGAAAAATCATACCCAATCTTAGACCCTGGATTGAAAGAAAACATGGAGAAATAGACAGATTACTAACACAAGCTCTAAGTGGACATGGAGTCTTCAACACCTATCTCCATGCAACAGGGAAAGCAAAAAATGACATATGCCTATACTGCGAACACGTAGACACACCAGAGCACGCCCTGTTCGAATGCACAAACTTCACAGAGGTAAGAGAGAAAACGGAAGGAAACGATGGAAAAATGACAGCGGAAAACGTGATGAGAAGAATGACGAAAAGTAAATCAGGATGGGATAAATATGCGGAAATGCTCACGGAAATAGGAAAAGGTAAGGGAAAAAGACAAAAGCCTCTCTGA
Protein
MREEEISRTKTEWAQDWQKKGKSTWTRKIIPNLRPWIERKHGEIDRLLTQALSGHGVFNTYLHATGKAKNDICLYCEHVDTPEHALFECTNFTEVREKTEGNDGKMTAENVMRRMTKSKSGWDKYAEMLTEIGKGKGKRQKPL

Summary

EMBL
GECU01032129    JAS75577.1    KQ971864    EFA13315.2    GAMC01020517    JAB86038.1    + More
GAMC01020519    GAMC01020515    JAB86040.1    DS497819    EFA11934.1    GALX01000600    JAB67866.1    KB632274    ERL91080.1    GAPW01002043    JAC11555.1    KB632419    ERL95303.1    GGFK01011357    MBW44678.1    GGFK01011482    MBW44803.1    GGFK01011045    MBW44366.1    GEHC01000964    JAV46681.1    GGFK01012648    MBW45969.1    KQ971309    EEZ99146.1    GFTR01008427    JAW07999.1    AB593321    BAK38639.1    GGMR01002122    MBY14741.1    GGMR01006977    MBY19596.1    GGMR01012534    MBY25153.1    KQ972691    KXZ75806.1    AB593323    BAK38643.1    GGFK01011630    MBW44951.1    GEZM01069016    JAV66683.1    GALA01001066    JAA93786.1    GGMR01020135    MBY32754.1    GGMR01005740    MBY18359.1    GEHC01000915    JAV46730.1    GECU01014493    JAS93213.1    GAPW01000192    JAC13406.1    KXZ75807.1    GALX01005145    JAB63321.1    KQ972544    KXZ75869.1    KQ971310    KYB29500.1    GAPW01003129    JAC10469.1    GALA01001776    JAA93076.1    KYB29499.1    KQ972982    KXZ75700.1    GGFJ01001453    MBW50594.1    AAZX01008655    GALA01001777    JAA93075.1    ABLF02031810    GGMR01010769    MBY23388.1    GEHC01001045    JAV46600.1    GGFJ01001454    MBW50595.1    GALX01004785    JAB63681.1    GECU01029521    JAS78185.1    GDHC01002080    JAQ16549.1    GALA01000302    JAA94550.1    KXZ75870.1    GAPW01002123    JAC11475.1    CH963857    KRF98317.1    GALX01006065    JAB62401.1    GGFL01001777    MBW65955.1    GFTR01004944    JAW11482.1    GAPW01002021    JAC11577.1    GGMR01011974    MBY24593.1    GGFL01004046    MBW68224.1    AAZX01013013    ABLF02013380    ABLF02013382    GALX01006869    JAB61597.1    ABLF02017307    GGMR01016419    MBY29038.1    GGFL01001583    MBW65761.1    GAPW01003605    JAC09993.1    GGFK01005660    MBW38981.1    APGK01020896    KB740258    ENN80981.1    GFTR01007160    JAW09266.1    KQ971388    KYB24913.1    KB632368    ERL93670.1    APGK01025048    KB740571    ENN80206.1    KQ972160    EFA13619.2    KU543679    AMS38363.1    ABLF02010223    KU543682    AMS38369.1    AAZX01025645    JXUM01056532    KQ561914    KXJ77178.1    HACL01000300    CFW94594.1    GGMR01008270    MBY20889.1    AXCM01017384    AXCM01017385    AAZX01012143    AAZX01012194    ABLF02014378    GGMR01010199    MBY22818.1    KB631774    ERL86016.1    GGFJ01001727    MBW50868.1    GGFJ01001369    MBW50510.1    GGFJ01001370    MBW50511.1    ABLF02013358    ABLF02013361    ABLF02054869    KU543683    AMS38371.1    GGMR01015518    MBY28137.1    GAPW01002982    JAC10616.1    GGMS01002352    MBY71555.1    ACPB03015998    ACPB03015999    ACPB03016000    ACPB03016001    AB090819    BAC57914.1    GDHF01029467    GDHF01011533    JAI22847.1    JAI40781.1   
Pfam
PF00078   RVT_1        + More
PF14529   Exo_endo_phos_2
PF00098   zf-CCHC
PF13966   zf-RVT
Interpro
IPR000477   RT_dom        + More
IPR005135   Endo/exonuclease/phosphatase       
IPR036691   Endo/exonu/phosph_ase_sf       
IPR001878   Znf_CCHC       
IPR036875   Znf_CCHC_sf       
IPR000663   Natr_peptide       
IPR026960   RVT-Znf       
SUPFAM
SSF56219   SSF56219        + More
SSF57756   SSF57756       
Gene 3D

Ontologies

Topology

Length:
143
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00492
Exp number, first 60 AAs:
0.00369
Total prob of N-in:
0.49338
outside
1  -  143
 
 

Population Genetic Test Statistics

Pi
272.988925
Theta
208.245001
Tajima's D
0.946872
CLR
0
CSRT
0.647917604119794
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号