SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO14496
Annotation
reverse_transcriptase_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 1.945
 

Sequence

CDS
ATGTGGTTCCACAGGCCCCGGAGAGTGCCACCTGTCGATGCCCATATCGTGGTTGGAGGCGTCCGTATCGGGGTCGGGGTGCAGTTGAAGTACCTCGGCCTCATTCTGGACAGTCGTTGGACCTTCCGTGCTCACTTTCAGAATCTGGTCCCTCGTTTGTTGGGGGTGGCCGGCGCGTTAAGCCGGCTCCTTCCCAATGTCGGGGGGCCTGACCAGGTGACGCGCCGTCTCTATACAGGGGTGGTGCGATCAATGGCCCTATACGGGGCGCCCGTGTGGGGCCAGTCCCTGGCCGTGGGGGTAGCGAAGCTGCTGCAACGGCCGCAACGCACCATCGCGGTCAGGGTCATCCGTGGTTATCGCACCATCTCTTTCGAGGCGGCGTGTGTACTGGCTGGGACGCCGCCTTGGGTCCTGGAGGCGGAGGCGCTTGCTGCTGACTATCAGTGGCGGGCTGACCTTCGTATCCGGGGCGTGGCACGTCCCAGCCCCAGTGTGGTCAGAGCGCGGAGGGCCCAATCTCGGCGGTCCGTGCTGGAGGCATGGTCCAGACGGCTGGCCGATCCTTCGGCTGGTCGTAGGACCGTCGAGGCGATTCGCCCGGTTCTTGTGAATTGGGTGAATCGTGACAGAGGACGCCTCACTTTCCGGCTCACGCAGGTGCTCACTGGGCATGGTTGCTTCGGTGAGTTCCTGCACCGGATCGGAGCCGAGCCGACGGCAGAGTGCCACCATTGTGGTTGCGGCTTGGACACGGCGGAGCACACGCTCGTCGCCTGCCCCGCATGGGAGGGGTGGCGCCGTGTCCTCGTCGCAAAAATAGGAAACGACTTGTCGTTGCCGAGTGTTGTGGCATCGATGCTCGGCGACGACGAGTCGTGGAAGGCGATGCTCGACTTCTGCGAGTGCACCATCTCGCAGAAGGAGGCGGCGGGGCGCGTGAGAGACACGCAAGCCCGCCGCCGTCGAGCGGGGGCCAGGGAGGCGGATCTCGCCCAAGCCCTGGCCCTCTAA
Protein
MWFHRPRRVPPVDAHIVVGGVRIGVGVQLKYLGLILDSRWTFRAHFQNLVPRLLGVAGALSRLLPNVGGPDQVTRRLYTGVVRSMALYGAPVWGQSLAVGVAKLLQRPQRTIAVRVIRGYRTISFEAACVLAGTPPWVLEAEALAADYQWRADLRIRGVARPSPSVVRARRAQSRRSVLEAWSRRLADPSAGRRTVEAIRPVLVNWVNRDRGRLTFRLTQVLTGHGCFGEFLHRIGAEPTAECHHCGCGLDTAEHTLVACPAWEGWRRVLVAKIGNDLSLPSVVASMLGDDESWKAMLDFCECTISQKEAAGRVRDTQARRRRAGAREADLAQALAL

Summary

EMBL
AB090825    BAC57926.1    AB126050    BAD86650.1    KZ150386    PZC71062.1    + More
AB078935    BAC06462.1    KZ150308    PZC71477.1    AB078931    BAC06456.1    AB078930    BAC06454.1    AB078929    BAC06452.1    KZ149896    PZC78733.1    KZ149950    PZC76665.1    D85594    BAA19776.1    RSAL01000481    RVE41577.1    LBMM01012027    KMQ86470.1    LBMM01008861    KMQ88580.1    LBMM01009494    KMQ88097.1    LBMM01014132    KMQ85305.1    LBMM01005707    KMQ91279.1    LBMM01003679    KMQ93242.1    LBMM01006954    KMQ90166.1    KQ414641    KOC66782.1    LBMM01006671    KMQ90407.1    LBMM01006657    KMQ90417.1    LBMM01019839    KMQ83438.1    QOIP01000010    RLU18098.1    LBMM01008682    KMQ88705.1    LBMM01005733    KMQ91252.1    LBMM01019838    KMQ83439.1    LBMM01005634    KMQ91349.1    LBMM01004272    KMQ92618.1    QOIP01000031    RLU14697.1    QOIP01000007    RLU20280.1    LBMM01002052    KMQ95336.1    LBMM01015018    KMQ84954.1    LBMM01006909    KMQ90209.1    LBMM01008349    KMQ88951.1    LBMM01007036    KMQ90099.1    LBMM01004634    KMQ92224.1    GGMR01011974    MBY24593.1    GGMR01016864    MBY29483.1    LBMM01006725    KMQ90373.1    LBMM01006063    KMQ90967.1    LBMM01015025    KMQ84953.1    LBMM01020849    KMQ83202.1    LBMM01005216    KMQ91703.1    LBMM01004505    KMQ92346.1    LBMM01003245    KMQ93755.1    LBMM01006110    KMQ90925.1    LBMM01009738    KMQ87908.1    LBMM01003988    KMQ92922.1    ABLF02005203    ABLF02041316    LBMM01002480    KMQ94776.1    GGMR01014918    MBY27537.1    GFXV01001748    MBW13553.1    LBMM01012595    KMQ86127.1    GGMR01015354    MBY27973.1    GGMR01006442    MBY19061.1    LBMM01007425    KMQ89740.1    LBMM01007659    KMQ89538.1    GGMR01019609    MBY32228.1    LBMM01014909    KMQ85000.1    ABLF02011238    LBMM01021647    KMQ83033.1    ABLF02015311    ABLF02015320    ABLF02034009    ABLF02043484    ABLF02004597    ABLF02041324    LBMM01014956    KMQ84982.1    ABLF02041886    GGMR01012534    MBY25153.1    ABLF02017307    ABLF02004854    ABLF02041317    ABLF02013380    ABLF02013382    LBMM01008422    KMQ88894.1    GGMS01012744    MBY81947.1    ABLF02016435    ABLF02016436    ABLF02064751    LBMM01012412    KMQ86235.1    GGMR01015159    MBY27778.1    GGMR01012877    MBY25496.1    GFXV01003903    MBW15708.1    LBMM01014122    KMQ85315.1    GGMR01005740    MBY18359.1    ABLF02023401    ABLF02029423    ABLF02060278    GGMR01006964    MBY19583.1    GGMR01004600    MBY17219.1    ABLF02026677    ABLF02032994    ABLF02059021    ABLF02064578    ABLF02026953   
Pfam
PF14529   Exo_endo_phos_2        + More
PF00078   RVT_1
PF01553   Acyltransferase
PF03372   Exo_endo_phos
PF07776   zf-AD
PF00096   zf-C2H2
PF17919   RT_RNaseH_2
PF00098   zf-CCHC
PF13843   DDE_Tnp_1_7
PF05699   Dimer_Tnp_hAT
Interpro
IPR000477   RT_dom        + More
IPR036691   Endo/exonu/phosph_ase_sf       
IPR005135   Endo/exonuclease/phosphatase       
IPR002123   Plipid/glycerol_acylTrfase       
IPR012934   Znf_AD       
IPR013087   Znf_C2H2_type       
IPR036236   Znf_C2H2_sf       
IPR001878   Znf_CCHC       
IPR036875   Znf_CCHC_sf       
IPR041577   RT_RNaseH_2       
IPR029526   PGBD       
IPR037220   BED_dom       
IPR012337   RNaseH-like_sf       
IPR008906   HATC_C_dom       
SUPFAM
SSF56219   SSF56219        + More
SSF57667   SSF57667       
SSF57756   SSF57756       
SSF53098   SSF53098       
SSF140996   SSF140996       
Gene 3D

Ontologies

Topology

Length:
337
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
1.71185
Exp number, first 60 AAs:
0.42701
Total prob of N-in:
0.07201
outside
1  -  337
 
 

Population Genetic Test Statistics

Pi
152.008133
Theta
40.577925
Tajima's D
3.694086
CLR
0.134352
CSRT
0.99690015499225
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号