SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO14395
Annotation
endonuclease-reverse_transcriptase_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 3.323
 

Sequence

CDS
ATGAGAACCCTTATCTTCTCCATATTCTTGTACGCTTCTGAGACGTGGACCCTCAAGGCCCGTACCCGATCGAGAATTGACGCATTTGAAATGTGGTGTTGGCGCAAAATGTTGGGCGTATCATGGACGGAGCGCCGAACAAATGTGTCAATTCTCGAGGAGCTAAACGTCAAGACCCGTCTATCTACAATCTGTATGCAGCGTCTCCTCAAGTACTTCGGACACGTGGCCCGACAAAATCCTGAGAACTTGGAAAAATTAATGGTTGTAGGTCACGTGGAAGGAAAGAGAAGTCGAGGAAGATTGCCAACCAGGTGGACGGCCATTATCAAGGAGGCCACAAACACCAGCGTCCCGGGCGCCATTAAGCAGGCCGAATGCAGGCAACATTGGAGAAAGCTGGTGCAAAAACTGAACCAAGGTGGTCACGACCCTCAGTAA
Protein
MRTLIFSIFLYASETWTLKARTRSRIDAFEMWCWRKMLGVSWTERRTNVSILEELNVKTRLSTICMQRLLKYFGHVARQNPENLEKLMVVGHVEGKRSRGRLPTRWTAIIKEATNTSVPGAIKQAECRQHWRKLVQKLNQGGHDPQ

Summary

EMBL
FJ265559    ADI61827.1    RSAL01000289    RVE42931.1    ODYU01003523    SOQ42419.1    + More
FJ265548    ADI61816.1    ODYU01001007    SOQ36619.1    FJ265546    ADI61814.1    ODYU01004401    SOQ44236.1    FJ265560    ADI61828.1    FJ265547    ADI61815.1    FJ265552    ADI61820.1    FJ265553    ADI61821.1    FJ265557    ADI61825.1    GU815090    ADF18553.1    KZ150203    PZC72267.1    MRZV01000056    PIK60437.1    MRZV01000940    PIK42365.1    MRZV01000378    PIK51329.1    MRZV01002322    PIK33998.1    MRZV01000817    PIK43880.1    MRZV01000994    PIK41715.1    MRZV01001216    PIK39650.1    MRZV01001207    PIK39730.1    MRZV01000196    PIK55924.1    AAGJ04055194    KZ150366    PZC71172.1    ODYU01006805    SOQ48998.1    KL363256    KL367985    KFD50217.1    KFD59415.1    NCKU01008836    RWS01655.1    NCKU01012182    RWS00163.1    BART01031562    GAH15691.1    AHAT01022938    KL363266    KL367526    KFD49675.1    KFD66333.1    KQ459603    KPI92872.1    AAGJ04021158    HACG01049248    HACG01049253    CEK96113.1    CEK96118.1    HACG01049251    HACG01049252    CEK96116.1    CEK96117.1    HACG01049244    HACG01049247    CEK96109.1    CEK96112.1    AAGJ04161766    NWSH01002736    PCG67606.1    HACG01049255    CEK96120.1    HACG01049245    CEK96110.1    HACG01049249    CEK96114.1    AHAT01015286    KZ149985    PZC75696.1    AHAT01009145    ABLF02042206    AAGJ04075245    ABLF02024992    ABLF02024994    ABLF02025002    ABLF02043975    NCKU01004395    RWS06003.1    RQTK01000685    RUS76136.1    GGMR01005851    MBY18470.1    RQTK01000360    RUS81011.1    GU815089    ADF18552.1    AJ132772    CAA10770.1    RQTK01000625    RUS76894.1    RQTK01000209    RUS84333.1    AAGJ04167631    KK852941    KDR13536.1    KK852482    KDR22935.1    AHAT01012943    ABLF02031909    GGMS01001437    MBY70640.1    GGMS01004979    MBY74182.1    GGMR01013640    MBY26259.1    AAGJ04128321    NWSH01000469    PCG76200.1    GGMS01006790    MBY75993.1    KK853131    KDR10935.1    KK853249    KDR09341.1    KK852843    KDR15156.1   
Pfam
PF00078   RVT_1        + More
PF14529   Exo_endo_phos_2
PF05699   Dimer_Tnp_hAT
PF03221   HTH_Tnp_Tc5
PF04218   CENP-B_N
Interpro
IPR000477   RT_dom        + More
IPR005135   Endo/exonuclease/phosphatase       
IPR036691   Endo/exonu/phosph_ase_sf       
IPR002138   Pept_C14_p10       
IPR008906   HATC_C_dom       
IPR006600   HTH_CenpB_DNA-bd_dom       
IPR007889   HTH_Psq       
IPR009057   Homeobox-like_sf       
SUPFAM
SSF56219   SSF56219        + More
SSF46689   SSF46689       
Gene 3D

Ontologies

Topology

SignalP
Position:   1 - 17,         Likelihood:  0.656338
 
 
Length:
146
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00437
Exp number, first 60 AAs:
0.00437
Total prob of N-in:
0.03339
outside
1  -  146
 
 

Population Genetic Test Statistics

Pi
278.360231
Theta
181.19229
Tajima's D
1.687308
CLR
0
CSRT
0.826708664566772
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号