SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO14391
Pre Gene Modal
BGIBMGA013783
Annotation
AF461149_1_transposase_[Bombyx_mori]
Location in the cell
Nuclear   Reliability : 1.93
 

Sequence

CDS
ATGGAGTGGACGCTTAAAGAAGACCGTGTTGCAGTTATTGCGTTGCATCGTTGCGGTTACGCGCCAATTCAAATTTTTAACATACTGAAAAATTTGAATATAACCAAAAGATTCGTTTATCGTACCATCAAACGATACAATGAAGACTCTAGTGTAGATGACAGGTCAAGAAGTGGTCGCCCTCGGTCTGTTAGGACTCCAGTAGTGATAAAAGCTGTGAAGGCGCGAATTCAAAGAAATCCCAAACAAGAGAGCTACAACAAACAAAATGATAAGGTGTACGCACACAGTAGTGAAGAAGCGAGCAACCGTATTCCGCGTGTCCAACGAGGTCATTTTCCAACCTCGCTCATGGTATGGTTGGGAGTTTCTTATTGGGGCTTAACAGAGGTACATTTTTGTGAGAAAGGTGTAAAAACGAATGCAGTTTTGTATCAAAATACAGTCCTGACGAACCTTGTGGAACCTGTTTCTCATACCATGTTCAATAACAGGCACTGGGTATTCCAACAAGATTCGGCGCCAGCTCATAGAGCGAAGAGCACACAAGACTGGCTGGCGGCGCGTGAAATCGACTTCATCCGGCACGAAGACTGGCCCTCCTCCAGTCCAGATTTGAATCCGTTAGATTACAAGATATGGCAACACTTGGAGGAAAAGGCGTGCTCAAAGCCTCATCCCAATTTGGAGTCACTCAAGACATCCTTGATTAAGGCAGCCGCCGATATTGACATGGACCTCGTTCGTGCTGCGATAGACGACTGGCCGAGCAGATTGAAGGCCTGTATTCAAAATCACGGAGGTCATTTTGAATAA
Protein
MEWTLKEDRVAVIALHRCGYAPIQIFNILKNLNITKRFVYRTIKRYNEDSSVDDRSRSGRPRSVRTPVVIKAVKARIQRNPKQESYNKQNDKVYAHSSEEASNRIPRVQRGHFPTSLMVWLGVSYWGLTEVHFCEKGVKTNAVLYQNTVLTNLVEPVSHTMFNNRHWVFQQDSAPAHRAKSTQDWLAAREIDFIRHEDWPSSSPDLNPLDYKIWQHLEEKACSKPHPNLESLKTSLIKAAADIDMDLVRAAIDDWPSRLKACIQNHGGHFE

Summary

Similarity
Belongs to the TGF-beta family.
Pfam
PF00019   TGF_beta        + More
PF13358   DDE_3
Interpro
IPR001839   TGF-b_C        + More
IPR029034   Cystine-knot_cytokine       
IPR017948   TGFb_CS       
IPR015615   TGF-beta-rel       
IPR009057   Homeobox-like_sf       
IPR036388   WH-like_DNA-bd_sf       
IPR038717   Tc1-like_DDE_dom       
SUPFAM
SSF57501   SSF57501        + More
SSF46689   SSF46689       
Gene 3D
PDB
5CR4     E-value=2.96317e-09,     Score=146

Ontologies

Topology

Subcellular location
Secreted  
Length:
271
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
1.25254
Exp number, first 60 AAs:
0.95494
Total prob of N-in:
0.08665
outside
1  -  271
 
 

Population Genetic Test Statistics

Pi
231.363612
Theta
49.49563
Tajima's D
2.779656
CLR
0
CSRT
0.968001599920004
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号