SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO14386
Annotation
PREDICTED:_uncharacterized_protein_LOC106110673_[Papilio_polytes]
Location in the cell
Nuclear   Reliability : 3.252
 

Sequence

CDS
ATGGATGAGAAATTAAAACCTATTTTAGAGGAAAATAAATACTTAAAATTAAAAGTAGAGAACTTGGAAAAGAAAATCGAAATTTTAGAGAGAGATAAGAAAACTAACAATATAATAATCCATGGATTGACAGAAGACGAGAAATCGACACCCGAGCTTATCGACAAGGTCAAAGATACAATAACAAAAGAATTAGGCATAGCAATCGAAAATTATGAATTCAACAAAATATATCGTATTGGTAAAACAAACAAAGGTAATCCATCAAAGGTAATCCGACCTATACTAATATGCTTGACTACTGGATGGAAAAAAGCGGAAATATTGAAAAATAAGAGAAAGTTAAAAGACCTGCATATCACGGAAGATTACTCTAAAGAAACCTTAGAAAAACGTAAGGCTTTACTACCACAACTCATGGAAGAACGGAGAAAAGGTAATTTCGCCTATTTAAGATATGATAAACTAATAATTAAAGAAAATAAATACGTCAAGGACTCGAGGAAGAGAGAACTCTCAATTTCACCACAAACAAACTCTCAATCCAAAAAAATTCAACCTTCAACTTCAGCCAAGAATAACAGAACGAATGCATTCGATTTGATGACGGTCTAA
Protein
MDEKLKPILEENKYLKLKVENLEKKIEILERDKKTNNIIIHGLTEDEKSTPELIDKVKDTITKELGIAIENYEFNKIYRIGKTNKGNPSKVIRPILICLTTGWKKAEILKNKRKLKDLHITEDYSKETLEKRKALLPQLMEERRKGNFAYLRYDKLIIKENKYVKDSRKRELSISPQTNSQSKKIQPSTSAKNNRTNAFDLMTV

Summary

EMBL
NWSH01001196    PCG72157.1    NWSH01004020    PCG65566.1    KZ149976    PZC75915.1    + More
NWSH01003397    PCG66369.1    JTDY01003098    KOB70157.1    NWSH01000260    PCG77926.1    NWSH01005231    PCG64345.1    JTDY01000539    KOB76734.1    JTDY01002536    KOB71226.1    BABH01024878    JTDY01000743    KOB76037.1    JTDY01000511    KOB76839.1    NWSH01003169    PCG66835.1    KZ150150    PZC72845.1    JTDY01001041    KOB75043.1    NWSH01002532    PCG68054.1    JTDY01007450    KOB65190.1    ODYU01000585    SOQ35630.1    ODYU01013311    SOQ60019.1    ODYU01000586    SOQ35631.1    JTDY01008572    KOB64508.1    JTDY01000484    KOB76970.1    JTDY01001949    KOB72466.1    FJ265564    ADI61832.1    NWSH01001771    PCG70189.1    ODYU01001637    SOQ38140.1    JTDY01001071    KOB74965.1    GDQN01002055    GDQN01002009    JAT88999.1    JAT89045.1    GBGD01002698    JAC86191.1    JTDY01001738    KOB73038.1    BABH01021795    JTDY01007191    KOB65392.1    JTDY01009161    KOB64038.1    NWSH01000023    PCG80652.1    ODYU01008249    SOQ51673.1    GBBI01000452    JAC18260.1    KQ459995    KPJ18566.1    JTDY01014369    KOB52037.1    JTDY01016948    KOB51874.1    NWSH01002039    PCG69337.1    JTDY01000843    KOB75692.1    GBGD01002692    JAC86197.1    BABH01040799    JTDY01000408    KOB77334.1    JTDY01000076    KOB79001.1    FJ265563    ADI61831.1    JTDY01010650    KOB58126.1    GEZM01094174    GEZM01094173    JAV55842.1    ACPB03011704    ACPB03011705    ACPB03011706    ACPB03011707    ACPB03011708    ACPB03011709    ACPB03011710    ACPB03011711    ACPB03011712    ACPB03011713    JTDY01002685    KOB70933.1    JTDY01001987    KOB72394.1    GBGD01002635    JAC86254.1    JTDY01009971    KOB62006.1    JTDY01002701    KOB70892.1    FJ265562    ADI61830.1    GFTR01003558    JAW12868.1    JTDY01000780    JTDY01000104    JTDY01000008    KOB75906.1    KOB78842.1    KOB79479.1    GEZM01063671    JAV69026.1    GEDC01026084    JAS11214.1    GEZM01039814    JAV81166.1    JTDY01000437    KOB77173.1    JTDY01000100    KOB78869.1    JTDY01001015    KOB75121.1    JTDY01000640    KOB76373.1    GFTR01003469    JAW12957.1    JTDY01008567    KOB64512.1    GEGO01006805    JAR88599.1    GEZM01082533    JAV61335.1    JTDY01002173    KOB71954.1    GBIH01002636    JAC92074.1    ODYU01010663    SOQ55918.1    GEGO01004713    JAR90691.1    GEGO01004657    JAR90747.1    JTDY01010526    KOB58179.1    JTDY01000977    KOB75230.1   
Pfam
PF14529   Exo_endo_phos_2        + More
PF00078   RVT_1
PF00501   AMP-binding
Interpro
IPR005135   Endo/exonuclease/phosphatase        + More
IPR036691   Endo/exonu/phosph_ase_sf       
IPR027124   Swc5/CFDP2       
IPR000477   RT_dom       
IPR004244   Transposase_22       
IPR020845   AMP-binding_CS       
IPR042099   AMP-dep_Synthh-like_sf       
IPR000873   AMP-dep_Synth/Lig       
IPR001680   WD40_repeat       
IPR015943   WD40/YVTN_repeat-like_dom_sf       
IPR011990   TPR-like_helical_dom_sf       
IPR036322   WD40_repeat_dom_sf       
SUPFAM
SSF56219   SSF56219        + More
SSF50978   SSF50978       

Ontologies

Topology

Length:
204
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00127
Exp number, first 60 AAs:
0
Total prob of N-in:
0.03948
outside
1  -  204
 
 

Population Genetic Test Statistics

Pi
79.486925
Theta
117.788515
Tajima's D
-1.020733
CLR
1652.226966
CSRT
0.134793260336983
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号