SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO14381
Pre Gene Modal
BGIBMGA013308
Annotation
PREDICTED:_irregular_chiasm_C-roughest_protein-like_[Bombyx_mori]
Location in the cell
Cytoplasmic   Reliability : 1.112 Nuclear   Reliability : 1.729
 

Sequence

CDS
ATGTTGTTTATCTTTTTTGTTAGTGTCAGTGCCAGTGTCAGTGCGTTTGGGGAGCAACGGTTCGCGCTAGAACCTCAAGATCAGACCGCCATATTAGGTTCCAGAGTGATCCTTCCGTGCAGAGTTGAGGAGAAGGCTGGGCAACTTCAGTGGACTAAGGATGACTTTGGACTCGGTACACACCGCCATCTGGCCGGATACGAGCGCTACAAAATGATTGGCAGCGACGAAGAAGGCGACTACTCGTTGGACATCAGAGAAGTTACGCTGGATGACGACGCAGCATATCAATGCCAAGTTAGCTCTGGACCGAGGGGTGAGCCAGCAATTCGGTCAAGGTACGCCCGACTGACGGTGCTGGTACCACCAGATCCTCCAAAGATACTTCGGGGGCCCGTCATTCCAGCTATAGAAGACAGAGAGCTGGATTTGGAGTGTGTTTCAGTAGGAGGAAAACCTCCAGCGGAGATAACGTGGGTCGACAATGACGGTGGAGTTTTGACTCAAGGTGTCACTTATACCGTGGAACCGATGGGTGATGGCAGAAGATTTACGGCGAGGTCTACCCTCAGAATACGTCCCAGACGCCAACACCACAATCAGACTTTTACTTGCCAAGCGCAGAACACTGCAGACAGGGCGTATAGATCTGTCAACGTCAAATTACAAGTCCAATACGCGCCTAAGGTCCGTCTCTTCATGAAATCCGGGTCAATAAAAGGGAGAATACAAGAAGGGGAAACATTAATAATAGGGTGCCAATCGAATGCCAACCCTAGTAATGTATCTTACAAATGGTACATAAACAATGATGAAGCAATTGGAGAAGTGAAAAATGAATTGGTAAGTATTCAATGA
Protein
MLFIFFVSVSASVSAFGEQRFALEPQDQTAILGSRVILPCRVEEKAGQLQWTKDDFGLGTHRHLAGYERYKMIGSDEEGDYSLDIREVTLDDDAAYQCQVSSGPRGEPAIRSRYARLTVLVPPDPPKILRGPVIPAIEDRELDLECVSVGGKPPAEITWVDNDGGVLTQGVTYTVEPMGDGRRFTARSTLRIRPRRQHHNQTFTCQAQNTADRAYRSVNVKLQVQYAPKVRLFMKSGSIKGRIQEGETLIIGCQSNANPSNVSYKWYINNDEAIGEVKNELVSIQ

Summary

EMBL
NWSH01000084    PCG79784.1    KZ149957    PZC76455.1    KQ458859    KPJ04832.1    + More
PZC76453.1    NWSH01000121    PCG79332.1    AGBW02014999    OWR40735.1    KQ460254    KPJ16356.1    LJIG01001327    KRT85613.1    KQ971321    KYB28680.1    KYB28679.1    EFA00099.1    JRES01001043    KNC25985.1    AY118686    AAM50546.1    BT083408    ACQ83322.1    GEZM01036660    GEZM01036657    GEZM01036656    JAV82535.1    GEZM01036659    GEZM01036658    GEZM01036655    JAV82537.1    ATLV01013115    KE524840    KFB37223.1    APGK01018010    APGK01018011    APGK01018012    APGK01018013    APGK01018014    APGK01018015    KB740064    ENN81761.1    KB632165    ERL89278.1    CH477251    EAT46033.1    DS231944    EDS28290.1    CH379064    EAL31716.3    KRT06480.1    CH902663    EDV30005.1    CH479197    EDW27871.1    OUUW01000015    SPP88532.1    AXCM01000249    EAT46031.1    CCAG010019211    APCN01001155    CH480825    EDW44055.1    JXJN01008112    GECZ01009876    JAS59893.1    AAAB01008846    EAA06355.4    JXJN01009949    JXUM01018125    KQ560503    KXJ82106.1    AJWK01023927    EAA06357.5    GBXI01005154    JAD09138.1    CH964239    EDW81949.1    AXCN02002018    ATLV01013099    KFB37203.1    CH954180    EDV45705.1    CM000162    EDX01302.2    GAMC01011307    GAMC01011306    GAMC01011305    JAB95248.1    GDHF01015366    JAI36948.1    AE014298    AAF45847.2    AAN09598.1    AFH07219.1    AFH07220.1    AFH07221.1    AFH07222.1    AGB95042.1    AL035436    CAB36503.1    AF196553    AJ289882    AAF86308.1    CAB96574.2    SPP88525.1    AXCN02002013    UFQT01000015    SSX17766.1    JXUM01051192    JXUM01051193    JXUM01051194    JXUM01051195    KQ561678    KXJ77827.1    GAKP01004353    JAC54599.1    JXUM01063713    KQ562264    KXJ76278.1    EDY72610.2    GDHF01000554    JAI51760.1    GDHF01032907    GDHF01028726    GDHF01010672    JAI19407.1    JAI23588.1    JAI41642.1    KRT06478.1    GAMC01016710    GAMC01016708    JAB89847.1    CP012528    ALC48822.1    CH933814    EDW05674.2    EDW81947.2   
Pfam
PF07679   I-set        + More
PF08205   C2-set_2
PF13895   Ig_2
PF07686   V-set
PF06682   SARAF
Interpro
IPR036179   Ig-like_dom_sf        + More
IPR003598   Ig_sub2       
IPR013098   Ig_I-set       
IPR013783   Ig-like_fold       
IPR013162   CD80_C2-set       
IPR003599   Ig_sub       
IPR007110   Ig-like_dom       
IPR013106   Ig_V-set       
IPR009567   SARAF       
SUPFAM
SSF48726   SSF48726       
Gene 3D
PDB
4OF8     E-value=6.18773e-83,     Score=781

Ontologies

Topology

SignalP
Position:   1 - 15,         Likelihood:  0.898563
 
 
Length:
285
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.02539
Exp number, first 60 AAs:
0.02539
Total prob of N-in:
0.00386
outside
1  -  285
 
 

Population Genetic Test Statistics

Pi
258.478592
Theta
176.870521
Tajima's D
1.490358
CLR
0.169872
CSRT
0.784210789460527
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号