SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO14328
Annotation
mariner_transposase_[Bombyx_mori]
Location in the cell
Cytoplasmic   Reliability : 1.29 Mitochondrial   Reliability : 1.245 Nuclear   Reliability : 1.513
 

Sequence

CDS
ATGGAATTGACTCGAGAAAATTCAAGAGCGATGATTTATTATGACTTTCGAAGTGGTTTAACACAAAAACAGTGTGTTGACCGGATGATTTCTGCATTTGGTGATGAAGCCCTATCCAAAACCACAATTTATCGCTGGTTTACTGAGTTTCAACGTGGACGTGTCAAGCTCAGTGATGTTCCCCGTCAAGGTCGTCCAAAAACTGCAGTCACCCAAGAAAACGTTGATGCTGTGCGTAAGCTGATTGAGGAAGATCGACATGTGACATACCGCGAAATTCAGGCAACTTTAGACATTGGCATGAGTCAAATACAAATAATCCTGCATGAACAATTAGGTGTAAAAAAGTTGTTTTACCGATGGATACCGCATTCGCTCTGTGAAGAGCAAAAAGCGGCTCGCGTTACTTGGTGCGTCAGAACTCTCGAAAGATTCCACGCAGGATCCTCAAATGCTGTATACAACATTGTATCAGGTGACGAATCCTGGATATACGCGTACGAACCCGAAACAAAAAACCAGTCACGAGTTTGGGTGTTCGAAAATGAGTTAAAGCCAACAAAAATTGTTCGTTCACGGAGTGTTGCAAAAAAAATGGTGGCCACGTTTATCTCCAAAGCCGGCCATGTTACGACTATTCCTCTTGAGGGACAAAGAACGGTTAATGCAGAATGGTATGCTAGCATTTTTTTGCCACAGGTCATTTCTGAACTCCGTAAAGAGAACTGCAACCGCCGCATCATCCTCCATCACGACAATGCGAGTTCTCACACCGCGCACAGAACAAAAGAGTTTTTAGAGCTAGAAAACATAGAATTATGA
Protein
MELTRENSRAMIYYDFRSGLTQKQCVDRMISAFGDEALSKTTIYRWFTEFQRGRVKLSDVPRQGRPKTAVTQENVDAVRKLIEEDRHVTYREIQATLDIGMSQIQIILHEQLGVKKLFYRWIPHSLCEEQKAARVTWCVRTLERFHAGSSNAVYNIVSGDESWIYAYEPETKNQSRVWVFENELKPTKIVRSRSVAKKMVATFISKAGHVTTIPLEGQRTVNAEWYASIFLPQVISELRKENCNRRIILHHDNASSHTAHRTKEFLELENIEL

Summary

Similarity
Belongs to the ETS family.
EMBL
DQ443409    ABF51498.1    GBGD01001983    JAC86906.1    GBBI01001865    JAC16847.1    + More
KX930998    APL98291.1    GECU01007301    JAT00406.1    GECL01002811    JAP03313.1    GL444487    EFN60885.1    GAKP01015435    JAC43517.1    NIVC01001798    PAA63957.1    GAKP01015436    JAC43516.1    DQ174779    ABA55502.1    NIVC01001731    PAA64652.1    U49974    AAC52011.1    AM906136    CAP20050.1    KQ982684    KYQ52352.1    LBMM01023556    KMQ82700.1    KX931001    APL98294.1    NIVC01000364    PAA84702.1    GALX01005282    JAB63184.1    GAHY01000550    JAA76960.1    NSIT01000395    PJE77748.1    KX930994    APL98287.1    AM906135    CAP20049.1    AM231072    CAJ76986.1    NEVH01020327    PNF21945.1    AM906133    CAP20047.1    AM906145    CAP20059.1    AM231082    CAJ76996.1    AM231079    CAJ76993.1    AM906142    AM906144    CAP20056.1    AM231080    CAJ76994.1    GBBI01001710    JAC17002.1    KL367509    KFD67959.1    LBMM01023216    KMQ82764.1    AM231070    CAJ76984.1    GFTR01005295    JAW11131.1    NEVH01017576    PNF23785.1    AM231069    CAJ76983.1    AM906151    AM906152    CAP20065.1    AM231074    CAJ76988.1    NEVH01008208    PNF34637.1    GEGO01006651    JAR88753.1    KFD67975.1    KX930996    APL98289.1    GECU01035151    JAS72555.1    GQ398105    ADB28039.1    GBGD01001947    JAC86942.1    GBGD01001923    JAC86966.1    KL363189    KFD57228.1    AM906154    CAP20068.1    KX931000    APL98293.1    GBBI01001812    JAC16900.1    GAHY01001080    JAA76430.1    KL363194    KFD56261.1    KL363310    KFD47909.1    NIVC01002911    PAA54417.1    LBMM01011730    KMQ86664.1    NIVC01001708    NIVC01001487    NIVC01000426    NIVC01000107    PAA64861.1    PAA67372.1    PAA83241.1    PAA90594.1    NIVC01000831    PAA76287.1    NEVH01025141    PNF15743.1    KL363182    KFD59075.1    LBMM01005538    KMQ91440.1    KL367501    KFD68789.1    KL363185    KFD58269.1    AM906137    CAP20051.1    NEVH01027114    NEVH01027075    NEVH01026089    NEVH01026087    NEVH01024426    NEVH01021956    NEVH01021925    NEVH01015301    NEVH01013964    NEVH01013194    NEVH01011885    NEVH01009393    NEVH01007824    NEVH01007823    NEVH01006721    NEVH01006578    NEVH01005888    NEVH01005885    NEVH01005277    NEVH01002149    NEVH01001358    PNF13652.1    PNF13785.1    PNF14826.1    PNF14870.1    PNF17130.1    PNF18970.1    PNF19346.1    PNF27270.1    PNF28165.1    PNF28197.1    PNF30137.1    PNF31284.1    PNF33174.1    PNF35196.1    PNF35254.1    PNF37314.1    PNF37715.1    PNF38363.1    PNF38519.1    PNF39139.1    PNF42450.1    PNF42722.1    NEVH01000249    PNF43951.1    AM906141    CAP20055.1    KX930999    APL98292.1    GAHY01001054    JAA76456.1    GAHY01000734    JAA76776.1    KFD58078.1    GGMS01001658    MBY70861.1    LBMM01017492    KMQ84067.1   
Pfam
PF13358   DDE_3        + More
PF17906   HTH_48
PF01359   Transposase_1
PF00178   Ets
PF00069   Pkinase
PF12474   PKK
PF08332   CaMKII_AD
PF02755   RPEL
Interpro
IPR038717   Tc1-like_DDE_dom        + More
IPR041426   Mos1_HTH       
IPR001888   Transposase_1       
IPR038765   Papain-like_cys_pep_sf       
IPR036390   WH_DNA-bd_sf       
IPR036388   WH-like_DNA-bd_sf       
IPR000418   Ets_dom       
IPR008271   Ser/Thr_kinase_AS       
IPR011009   Kinase-like_dom_sf       
IPR017441   Protein_kinase_ATP_BS       
IPR000719   Prot_kinase_dom       
IPR022165   PKK       
IPR013543   Ca/CaM-dep_prot_kinase-assoc       
IPR032710   NTF2-like_dom_sf       
IPR004018   RPEL_repeat       
SUPFAM
SSF54001   SSF54001        + More
SSF46785   SSF46785       
SSF56112   SSF56112       
SSF54427   SSF54427       
Gene 3D
PDB
5HOO     E-value=2.77508e-18,     Score=224

Ontologies

Topology

Subcellular location
Nucleus  
Length:
273
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00408000000000001
Exp number, first 60 AAs:
0.00099
Total prob of N-in:
0.08183
outside
1  -  273
 
 

Population Genetic Test Statistics

Pi
36.950877
Theta
24.384714
Tajima's D
1.157794
CLR
0
CSRT
0.705414729263537
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号