SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO14205
Pre Gene Modal
BGIBMGA014047
Annotation
PREDICTED:_fatty_acyl-CoA_reductase_1-like_[Bombyx_mori]
Location in the cell
PlasmaMembrane   Reliability : 3.009
 

Sequence

CDS
ATGTCAGAAAGACTGCAGTCACAATTAAACGAGCCAGTATACGACAATTTACGATCTCAACAACCAGATTTCGCTCGGAAAGTGATACCGGTCGAAGGCGACATCTCAGAACTAGGGGTCGGCCTGAAAGATGAAGATAGGATGAAGCTTGCGCAAGAGGTGAATGTGATATTCCATGTGGCTGCCACGACCAGGTTCGAAGAGCCACTGAAGAAGGCCACATTCGTCAACGTCAGAGGAACAAGGGAGATCCTAGAACTGGCCAAATGCTGCAAAGATCTAAGGTCCTTCGTACACGTGTCAACTGCGTTCTCTAATGCAACCAAGAGTAGAATAAATCACGATTTGGAAGAGAAAATCTATGAAAGCCCTGTCCCTCCAGAAGTCATGATACAGCTCGCGGAGACAGTCGAAGAATGCAGACTCAACGCGATCACTGCTGATTTGATAAGGGACTGGCCCAACACGTACTGCTTCACGAAGGCCATAGCTGAGGATGTCGTGCGTACAATGGGCAAGGATTTACCTGTGGCCATAGTGAGGCCACCCGTAGGCAAGTATTCAAGGGCTTTTCTTTCAGAAATAGTTAAAGTCGAGACATATAAATATTTTGTAACTGGCCACATGTATAGTTTAACACCGGACCTCTTATGTGACGATCGAAGCAATCCATTATATTTTCCGTTTTCAGTTGTCTGCACGCTCAATGAACCCACACCTGGATGGCTGGATATGAGCTCGGTGATTGGTCCAAGCGGGATATTTTTGACATTAATGCTAGGCGTTATGCACGTAATTTTAAGGAGTGATGTTAGCATTCCAATAATGCCCGTGGATTACGTCAACAATGCGGTAATAGCAACAGCATCGTATACCAATAAACGTTACAATAAGAATGAAAAAGGAATTAAAGTTTATAATATAAGCTGTTCTGGGAGCAAAATTGAAACATCTTTTGTGTCTGATTTCCTGAACAATCCTAACACACAACAGTACGCTACGCCGAAAGCCGTTTGGTACTGTTATGGTTTTGAGACCAGTAGTGATGTTGTATTTTGGTTGTTAACATGGCTACTGCATTATATACCTGCGTATGTAGCCGACTTCGTGTTTAATGTGACCTCCATGAAGCGTCCTGAGGGCATAAAGTCATTCGTTAAAATGTATGAAAAGATATACAACATGTCTTTGTTGTACGGCTATTTCCTGAGGAACCAGTGGAATCTTGTCGATGACAACACCGTGGCCATGTTGAACCAAATGTCAAAAACGGACAGGATATTGTTCAATTTTGATGTTGCGAAGATCGATTGGTCGCACTATATGTCGATATGGTTGATAGGCATAAGAAAGTTCATCATTAAAGACGGCCTCAAAGACAGCGAATATGGCCAGTACTCTGAATACGTGACATTTATAGGAATATTTAAATCGGTTATTCATACCAATAAGGCTATCGATAATATTCAAAAGCTATACTACTTGCGAACATTCCTTAAGGGACAGCCCTATGAATTCGTTAAAAATCTTCCTCTGAATAGTGAAAGTTATAACGAAGCCATGCAATTGTTACACAACAGATACTATAACAAATACAAAATCATATCTGAGCACGTTAATGCCCTCTTAGATCTGGAAAAACTTTCCACATTTGTAGGAGCTAAAGAAATTAGACAATTTGTTTCCACAATCCGTCAAAATTTGGCAGCTTTAAATAATTTAGATGCAAACGTGGATGCGTGGAACCCTATCCTGTTGGGCATAGTAACACGTAAGCTCGACACGTACAGTGCTCGCTCTTATCAGTTGGAAAGAAACCAGGAACAAGAGCCAACTATGGGTGACCTTTTAGCTTATATGGACAAGCGTGCCCTGGCGCTTGAAAACACAGACGTCAAGCAAGATGTTGCAGCTCCAACAACTGCCAAGGGCAGAGTAAGCTTAGCAGCCACGGCCAAGCCTGCAATGGACTGCATCTACTATCATAATGAGATGTTTCAATCATTGGATTTTTTACAAGCTAAAATTGTGAAGACCCAAAAGTTTCCTGAGGTGAAGTCTAAAAATAGCCCCAGAGGAGAGATCCCTGCAGATCGTAAAGTAGATATTATACAGAAGCTTGTACCTTTGATGCCTGAGAATAGAAGAGATTTTTGAATGGACATCGCTTTAGCTTTGGAGATCGAGCAGGTCTCGCGTCAGAAGGCGCTGGAGGAGGAAGCGCTTCGGGGCGAGTCGGCTGTGCGGCAGTTCTACGCGGGAACCACAGCGCTGATCACTGGAGGGACGGGCTTCATCGGGAAACAACTCATAGAGAAGCTTCTAAGATCGTGTGACGTTAAGCGGATTTACATACTGATGAGGTCGAAAAAAGGGAAATCAATGTCAGAAAGACTGCAGTCACAATTAAACGAGCCAGTATACGACAATTTACGATCTCAACAACCAGATTTCACTCGGAAAGTTATACCGGTGGAAGGCGACATCTCAGAGCTAGGCGTCGGCCTGAACAACGAAGACAGGATGAAGCTTGCGCAAGAGGTGAATGTGATATTCCATGTGGCTGCCACGACCAGGTTCGAAGAGCCACTGAAGAAGGCCACATTCATCAACGTCAGAGGAACCAGGGAGATCATGGAATTGGCCAAATGCTGCAAAGATCTAAGGTCCTTCGTACACGTGTCAACTGCGTTCTCTAATGCAACCAAGAGTAAAATAAATCACGATTTGGAAGAGAAAATCTATGAAAGCCCTGTCCCTCCGGAAGTCATGATACAGCTCGCGGAGACAGTCGAAGAATGCAGACTCAACGCGATCACTGCTGATTTGATAAGGGACTGGCCCAACACGTACTGCTTCACGAAGGCCATAGCTGAGGATGTCGTGCGTACAATGGGCAAGGATTTACCTGTGGCCATAGTGAGGCCACCCGTAGGCAAGTATTCAAGGGCTTTTCTTTCAGAAATAGTTAAAGTCGAGACATATAAATATGTAGTAACTGGCCACATGTGTAGTTTAACACCGGACCTCTTATCTTTTGTGTCTGATTTCCTGAACAATCCTAACACACAACAGTACGCTACGCCGAAAGCCGTTTGGTACTGTTATGGTTTTGAGACCAGTAGCGATGTTGTATTTTGGTTGTTAACATGGCTACTGCATTATATACCTGCGTATGTAGCCGACTTCGTGTTTAATGTGACCTCCATGAAGCGTCCTGAGGGCATAAAGTCATTCGTTAAAATGTATGAAAAGATATACAACATGTCTTTGTTGTACGGCTATTTCCTGAGGAACCAGTGGAATCTTGTCGATGACAACACCGTGGCCATGTTGAACCAAATGTCAAAAACGGACAGGATATTGTTCAATTTTGATGTTGCGAAGATCGATTGGTCGCACTATATGTCGATATGGTTGATAGGCATAAGAAAGTTCATCATTAAAGACGGCCTCAAAGACAGCGAATATGTTGTTTCATTTACTAATATATTATTAGTATTAAGCATGCAAAAAATAAATAGTTCCAGAATGGACATCGCTTTAGCGTTGGAGATTGAGCAGGTTTCGCGTCAGAAGGCGCTGGAAGAAGAAGCGCTCCGCGGCGAGTCGGCTGTGCGGCAGTTCTACGCGGGAACCACAGCGCTGATCACTGGAGGGACGGGCTTCATCGGGAAACAACTCATAGAGAAGCTTCTAAGATCATGCGACGTTAAGCGAATTTACATATTGATGAGGTCGAAAAAAGGGAAATCAATGCCAGAAAGACTGCAGTCACAATTTAATGAGCCAGTATACGACAATTTACGATCTCAACAACCAGATTTCGCTCGGAAAGTGATACCGGTCGAAGGCGACATCTCAGAACTAGGGGTCGGCCTGAACGATGAAGACAGGATGAAGCTTGCCCAAGAGGTGAATGTGATATTCCATGTGGCTGCCACGACCAGGTTCGAAGAGCCACTGAAGAAGGCCACATTCATCAACGTCAGAGGAACCAGGGAGATCTTGGAACTGGCCAAATGCTGCAAAGATCTAAGATCCTTCGTACACGTGTCAACCGCATTCTCTAATGCAACCAAGAGCAGAATAAATCACAATTTGGAGGAGAAAATCTATGAAAGCCCTGTCCCTCCGGAAGTCATGATAAATCTCGCGAAGACAGTCGAAGAATGCAGACTCAACGCGATCACTGCTGATTTGATAAGGGACTGGCCCAACACGTACTGCTTCACAAAGGCCATAGCGGAGGATGTCGTGCGTACAATGGGCAAGGATTTACCTGTGGTCATAGTGAGGCCACCCATAGTTATCTGCACGCTCAATGAACCCACACCTGGATGGGTGGATATGAGCTCGGTGATCGGTCCAAGCGGGGTACTTTTGACATTAATGCTAGGCGTTATGCACGTAGTTTTAACGAGTGATATTAGCATTCCAATAGTGCCCGTGGACTACGTCAATAATGCGGTAATAGCAACAGCATCGGATACCAATGTACGTTACAATAAGAATGAAAAAGAAATTAAAGTTTATAATATAAGCTGTTCTGGGAGCAAAATTGAAACATCTTGTATGTCTGATTTCCTGAAGAATCCTAACACACTAGAGTACGCTACACCGAAAGCCGTTTGGTATTGTTATGGTTTTGGGACCGGAAGTGATGTTGTATTCTGGTTGTCAACATGGCTATTGCATTACATACCTGCATATGTAGCCGACTTCGTGTTTAATGTGACCTCCATGAAGCGACCTGAGGGCATAAAGTCATTCGTTAAATTGTATGAAAAGATATACAAAATGTCTATGTTGTACGGCTATTTCCTGAGGAACCAGTGGAATTTTGTCGATGACAACACCGTGGCCATGTTGAACCAAATGTCAAAAACTGACAGGATATTGTTCAATTTTGATGTTGCGAAGATCGATTGCTCGCGTTTTATGGCGATCTGGTGCATCGGCTTAAGAAAGTTTATTTTGAAGGACGGCCTCAAGAACAGCGAATATGCTAAATAA
Protein
MSERLQSQLNEPVYDNLRSQQPDFARKVIPVEGDISELGVGLKDEDRMKLAQEVNVIFHVAATTRFEEPLKKATFVNVRGTREILELAKCCKDLRSFVHVSTAFSNATKSRINHDLEEKIYESPVPPEVMIQLAETVEECRLNAITADLIRDWPNTYCFTKAIAEDVVRTMGKDLPVAIVRPPVGKYSRAFLSEIVKVETYKYFVTGHMYSLTPDLLCDDRSNPLYFPFSVVCTLNEPTPGWLDMSSVIGPSGIFLTLMLGVMHVILRSDVSIPIMPVDYVNNAVIATASYTNKRYNKNEKGIKVYNISCSGSKIETSFVSDFLNNPNTQQYATPKAVWYCYGFETSSDVVFWLLTWLLHYIPAYVADFVFNVTSMKRPEGIKSFVKMYEKIYNMSLLYGYFLRNQWNLVDDNTVAMLNQMSKTDRILFNFDVAKIDWSHYMSIWLIGIRKFIIKDGLKDSEYGQYSEYVTFIGIFKSVIHTNKAIDNIQKLYYLRTFLKGQPYEFVKNLPLNSESYNEAMQLLHNRYYNKYKIISEHVNALLDLEKLSTFVGAKEIRQFVSTIRQNLAALNNLDANVDAWNPILLGIVTRKLDTYSARSYQLERNQEQEPTMGDLLAYMDKRALALENTDVKQDVAAPTTAKGRVSLAATAKPAMDCIYYHNEMFQSLDFLQAKIVKTQKFPEVKSKNSPRGEIPADRKVDIIQKLVPLMPENRRDFXMDIALALEIEQVSRQKALEEEALRGESAVRQFYAGTTALITGGTGFIGKQLIEKLLRSCDVKRIYILMRSKKGKSMSERLQSQLNEPVYDNLRSQQPDFTRKVIPVEGDISELGVGLNNEDRMKLAQEVNVIFHVAATTRFEEPLKKATFINVRGTREIMELAKCCKDLRSFVHVSTAFSNATKSKINHDLEEKIYESPVPPEVMIQLAETVEECRLNAITADLIRDWPNTYCFTKAIAEDVVRTMGKDLPVAIVRPPVGKYSRAFLSEIVKVETYKYVVTGHMCSLTPDLLSFVSDFLNNPNTQQYATPKAVWYCYGFETSSDVVFWLLTWLLHYIPAYVADFVFNVTSMKRPEGIKSFVKMYEKIYNMSLLYGYFLRNQWNLVDDNTVAMLNQMSKTDRILFNFDVAKIDWSHYMSIWLIGIRKFIIKDGLKDSEYVVSFTNILLVLSMQKINSSRMDIALALEIEQVSRQKALEEEALRGESAVRQFYAGTTALITGGTGFIGKQLIEKLLRSCDVKRIYILMRSKKGKSMPERLQSQFNEPVYDNLRSQQPDFARKVIPVEGDISELGVGLNDEDRMKLAQEVNVIFHVAATTRFEEPLKKATFINVRGTREILELAKCCKDLRSFVHVSTAFSNATKSRINHNLEEKIYESPVPPEVMINLAKTVEECRLNAITADLIRDWPNTYCFTKAIAEDVVRTMGKDLPVVIVRPPIVICTLNEPTPGWVDMSSVIGPSGVLLTLMLGVMHVVLTSDISIPIVPVDYVNNAVIATASDTNVRYNKNEKEIKVYNISCSGSKIETSCMSDFLKNPNTLEYATPKAVWYCYGFGTGSDVVFWLSTWLLHYIPAYVADFVFNVTSMKRPEGIKSFVKLYEKIYKMSMLYGYFLRNQWNFVDDNTVAMLNQMSKTDRILFNFDVAKIDCSRFMAIWCIGLRKFILKDGLKNSEYAK

Summary

Uniprot
ProteinModelPortal
PDB
4W4T     E-value=1.06146e-09,     Score=158

Ontologies

GO

Topology

Length:
1671
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
33.7837400000001
Exp number, first 60 AAs:
9e-05
Total prob of N-in:
0.11208
outside
1  -  1671
 
 

Population Genetic Test Statistics

Pi
2.040333
Theta
20.802558
Tajima's D
-1.810513
CLR
163.963064
CSRT
0.0260486975651217
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号