SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO14203
Pre Gene Modal
BGIBMGA011140
Annotation
PREDICTED:_fatty_acyl-CoA_reductase_1-like_[Bombyx_mori]
Full name
Fatty acyl-CoA reductase      
Location in the cell
Cytoplasmic   Reliability : 1.432 Mitochondrial   Reliability : 1.705
 

Sequence

CDS
ATGGACAGCGCTTTGGCTTTGGAGATCGAGCAGGTCTCGCGTCAGAAGGCGCTGGAGGAGGAAGCGCTTCGCGGCGAGTCGGCTGTGCGGCAGTTCTACGCGGGAACCACAGCGCTGATCACTGGAGGGACGGGCTTCATCGGGAAACAACTCATAGAGAAGCTTCTAAGGTCGTGCGACGTTAAACGAATTTACCTGTTGATTAGGTCGAAGAAAGGGAAATCGATGCAAGAGAGACTAAAGTCACAATTAAATGATCCAGTATACGACAATTTACGGTCTCAACAACCAGATTTCACTCGGAAAGTTATACCGGTGGAAGGCGACATCTCAGAACTAGGCGTCGGCCTGAACAACGAAGACAGGATGAAGCTTGCGCAAGAGGTGAATGTGATATTCCATGTGGCTGCCACGACCAGGTTCGAAGAGCCACTGAAGAAGGCCACATTCATCAACGTCAGAGGAACCAGGGAGATCATGGAATTGGCCAAATGCTGCAAAGATCTAAGGTCCTTCGTACACGTGTCAACTGCGTTCTCTAATGCAACCAAGAGCAGAATAAATCACGATTTGGAAGAGAAAATCTATGAAAGCCCTGTCCCTCCGGAAGTCATGATACATCTCGCGGAGACAGTCGAAGAATGCAGACTCAACGCGATCACTGCTGATTTGATAAGGGACTGGCCCAACACGTACTGTTTCACGAAGGCCATAGCCGAGGATGTCGTGCGTACAATGGGCAAGGATTTACCTGTGGCCATAGTGAGGCCACCCGTAGTTATCTGCACGCTCAATGAACCCACTCCTGGATGGGTGGATATGAGCTCGGTGATCGGTCCTAGTGGGGTAAGTGCAAATCAAAGTTGGGACTTGTTAATAGCGGTTCGCACAGTGTACATAGTTGGGGTTTATTTTAAGATTTTTAAGCACACCCATGGTAACACCTTACTGCCCAATTCTCAAGCGAAGTAA
Protein
MDSALALEIEQVSRQKALEEEALRGESAVRQFYAGTTALITGGTGFIGKQLIEKLLRSCDVKRIYLLIRSKKGKSMQERLKSQLNDPVYDNLRSQQPDFTRKVIPVEGDISELGVGLNNEDRMKLAQEVNVIFHVAATTRFEEPLKKATFINVRGTREIMELAKCCKDLRSFVHVSTAFSNATKSRINHDLEEKIYESPVPPEVMIHLAETVEECRLNAITADLIRDWPNTYCFTKAIAEDVVRTMGKDLPVAIVRPPVVICTLNEPTPGWVDMSSVIGPSGVSANQSWDLLIAVRTVYIVGVYFKIFKHTHGNTLLPNSQAK

Summary

Description
Catalyzes the reduction of fatty acyl-CoA to fatty alcohols.
Catalytic Activity
a long-chain fatty acyl-CoA + 2 H(+) + 2 NADPH = a long-chain primary fatty alcohol + CoA + 2 NADP(+)
Similarity
Belongs to the fatty acyl-CoA reductase family.
EC Number
1.2.1.84
EMBL
BABH01035122    BABH01035123    BABH01035124    BABH01035129    BABH01035130    BABH01035131    + More
BABH01035132    BABH01042202    BABH01042203    BABH01042204    BABH01035110    NWSH01000263    PCG77898.1    NWSH01000368    PCG76936.1    PCG77899.1    PCG76935.1    ODYU01004617    SOQ44684.1    KZ150217    PZC72129.1    NWSH01000230    PCG78176.1    PZC72126.1    ODYU01001262    SOQ37234.1    PCG76937.1    NWSH01003107    PCG66934.1    KZ149959    PZC76396.1    PZC76395.1    KT261699    ALJ30239.1    NWSH01001446    PCG71213.1    KZ150147    PZC72871.1    MF687542    ATJ44468.1    AGBW02013183    OWR43905.1    PZC72127.1    ODYU01010853    SOQ56210.1    KQ460890    KPJ10851.1    KQ459593    KPI96440.1    KPI96441.1    KQ460036    KPJ18429.1    NWSH01001490    PCG71095.1    KPI96442.1    ODYU01004416    SOQ44264.1    JX989158    AGR49317.1    KPI96679.1    KT261695    ALJ30235.1    KU755476    ARD71186.1    KP237926    MF687596    AKD01779.1    ATJ44522.1    PZC72130.1    KP237913    MF687534    AKD01766.1    ATJ44460.1    KPI96403.1    KPJ10852.1    KJ622061    AID66649.1    NWSH01000716    PCG74636.1    ODYU01004649    SOQ44753.1    BABH01035163    BABH01035164    KPJ18430.1    NEVH01002545    PNF42310.1    AGBW02011118    OWR47192.1    KK852740    KDR17399.1    KB632003    ERL87876.1    APGK01044237    APGK01044238    KB741021    ENN75098.1    PNF42309.1    KQ976417    KYM89582.1    ADTU01007436    ADTU01007437    QOIP01000002    RLU25314.1    NNAY01001641    OXU23345.1    KQ980903    KYN11612.1    KQ982576    KYQ54647.1    KU963289    ANN23959.1    CVRI01000065    CRL05837.1    GL887695    EGI70414.1    KQ978379    KYM94471.1    NNAY01001243    OXU24628.1    GEZM01061226    JAV70627.1    UFQS01001285    UFQT01001285    SSX10116.1    SSX29838.1    AJWK01013757    KQ981905    KYN33349.1    GL443286    EFN62238.1    GEDC01006523    JAS30775.1    GL761538    EFZ23139.1    KQ776822    OAD52165.1    GL447283    EFN86604.1    GBGD01001246    JAC87643.1    GL440368    EFN65993.1    JRES01001250    KNC24227.1    KQ435694    KOX80980.1    MG573160    AWJ25022.1    GBHO01038325    GBHO01038321    GBRD01012464    GDHC01011251    JAG05279.1    JAG05283.1    JAG53360.1    JAQ07378.1    GBYB01002483    JAG72250.1    AJWK01024997    AJWK01024998    AJWK01024999    ACPB03001017    NEVH01011924    PNF31087.1    GEDC01000976    JAS36322.1    JT406763    AHH37716.1    KQ414617    KOC68027.1    GBHO01025676    JAG17928.1    ADTU01015701    ADTU01015702    KQ971345    EFA05024.1    GDHC01012276    JAQ06353.1    EFN62239.1   
Pfam
PF07993   NAD_binding_4        + More
PF03015   Sterile
Interpro
IPR026055   FAR        + More
IPR013120   Male_sterile_NAD-bd       
IPR036291   NAD(P)-bd_dom_sf       
IPR033640   FAR_C       
SUPFAM
SSF51735   SSF51735       
PDB
4W4T     E-value=8.37677e-11,     Score=160

Ontologies

Topology

Length:
323
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.51029
Exp number, first 60 AAs:
0.14347
Total prob of N-in:
0.01033
outside
1  -  323
 
 

Population Genetic Test Statistics

Pi
19.340922
Theta
22.526961
Tajima's D
-0.503088
CLR
0.272552
CSRT
0.24058797060147
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号