SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO14200
Pre Gene Modal
BGIBMGA011140
Annotation
PREDICTED:_fatty_acyl-CoA_reductase_1-like_[Bombyx_mori]
Full name
Fatty acyl-CoA reductase      
Location in the cell
Cytoplasmic   Reliability : 2.554
 

Sequence

CDS
ATGGACAGCGCTCTGGCTTTGGAGATCGAGCAGGTCTCGCGTCAGAAGGCGCTGGAGGAGGAAGCGCTTCGCGGCGAGTCGGCTGTGCGGCAGTTCTACGCGGGAACCACAGCGCTGATCACTGGAGGGACGGGCTTCATCGGGAAACAACTCATAGAGAAGCTTCTAAGATCGTGCGACGTTAAGCGGCTTTACATATTGGCACGATCGAAAAAGGGACTGTCTATGGAAGAAAGGCTCCAGTTACAATTTAAAGATCCTGTATACGACAATTTACGGTCTCAACAACCAGATTTCGCTCGGAAAGTGATACCTGTCGAAGGTGACATCTCAGAACTAGGCGTCGGCTTGAACGACGAAGACAGGATGAAGCTTGAGCAAGAGGCGAATGTCATATTCCACGTGGCCGCCACGACCAGGTTCGAAGAGCCACTAAAGAAGGCCACATTCATCAACGTCAGAGGAACCAGGGAGATCCTTGAATTGGCCAAATGCTGCAAAAATCTAAGATGCTTCGTACACGTGTCAACTGCGTTCTTCAATGCCACGAAGACCAAAATAAATCACACCATTGAGGAGAAATTCTATGAAAGCCCTATCCCTCCGGAAGTCATGATACAGCTCGCGGAGACAGTCGAAGAATGCAGACTCAACGCGATCACTGCTGATTTGATAAGGGACTGGCCCAACACGTACTGCTTCACGAAGGCCATAGCGGAGGATGTCGTGCGTACAATGGGCAAGGCTTTACCTGTGGCCATAGTGAGGCCACCCGCAGGCAAGTATTCAAGGGCTCTTCTTTCCGAAATAGTATAG
Protein
MDSALALEIEQVSRQKALEEEALRGESAVRQFYAGTTALITGGTGFIGKQLIEKLLRSCDVKRLYILARSKKGLSMEERLQLQFKDPVYDNLRSQQPDFARKVIPVEGDISELGVGLNDEDRMKLEQEANVIFHVAATTRFEEPLKKATFINVRGTREILELAKCCKNLRCFVHVSTAFFNATKTKINHTIEEKFYESPIPPEVMIQLAETVEECRLNAITADLIRDWPNTYCFTKAIAEDVVRTMGKALPVAIVRPPAGKYSRALLSEIV

Summary

Description
Catalyzes the reduction of fatty acyl-CoA to fatty alcohols.
Catalytic Activity
a long-chain fatty acyl-CoA + 2 H(+) + 2 NADPH = a long-chain primary fatty alcohol + CoA + 2 NADP(+)
Similarity
Belongs to the fatty acyl-CoA reductase family.
EC Number
1.2.1.84
EMBL
BABH01035122    BABH01035123    BABH01035124    BABH01035110    BABH01035129    BABH01035130    + More
BABH01035131    BABH01035132    BABH01042202    BABH01042203    BABH01042204    NWSH01000368    PCG76936.1    KZ150217    PZC72129.1    PCG76935.1    NWSH01000263    PCG77898.1    PCG77899.1    ODYU01001262    SOQ37234.1    ODYU01004617    SOQ44684.1    KT261699    ALJ30239.1    PZC72127.1    NWSH01000230    PCG78176.1    NWSH01003107    PCG66934.1    NWSH01001490    PCG71095.1    PZC72126.1    NWSH01001446    PCG71213.1    KZ149959    PZC76396.1    PCG76937.1    PZC76395.1    ODYU01010853    SOQ56210.1    KZ150147    PZC72871.1    MF687542    ATJ44468.1    KQ459593    KPI96441.1    KQ460890    KPJ10851.1    AGBW02013183    OWR43905.1    KPI96440.1    KPJ10852.1    KQ460036    KPJ18429.1    JX989158    AGR49317.1    KPI96679.1    KT261695    ALJ30235.1    PZC72128.1    KU755476    ARD71186.1    PZC72879.1    PZC72130.1    KP237926    MF687596    AKD01779.1    ATJ44522.1    KPI96403.1    KP237913    MF687534    AKD01766.1    ATJ44460.1    KJ622061    AID66649.1    NWSH01000716    PCG74636.1    ODYU01004416    SOQ44264.1    KPI96442.1    ODYU01004649    SOQ44753.1    AGBW02011118    OWR47192.1    KPJ18430.1    BABH01035163    BABH01035164    EU817393    ACJ06508.1    APGK01044237    APGK01044238    KB741021    ENN75098.1    KB632003    ERL87876.1    LADJ01066115    KPJ21681.1    KK852740    KDR17399.1    KF805978    AIS85929.1    NEVH01002545    PNF42310.1    GEZM01061226    JAV70627.1    UFQS01001285    UFQT01001285    SSX10116.1    SSX29838.1    CVRI01000065    CRL05837.1    KQ982194    KYQ59115.1    PNF42309.1    LBMM01000418    KMQ98413.1    NNAY01001641    OXU23345.1    AJWK01013757    QOIP01000002    RLU25314.1    GL443286    EFN62238.1    KQ979039    KYN23453.1    ADTU01015701    ADTU01015702    KQ971345    EFA05090.1    KQ976417    KYM89582.1    GEZM01093770    JAV56139.1    ADTU01007436    ADTU01007437    AJWK01024997    AJWK01024998    AJWK01024999    NEVH01011924    PNF31087.1    NNAY01001243    OXU24628.1    GL888353    EGI62240.1    GBHO01025676    JAG17928.1    GDHC01012276    JAQ06353.1    KJ622062    AID66650.1    GBHO01038325    GBHO01038321    GBRD01012464    GDHC01011251    JAG05279.1    JAG05283.1    JAG53360.1    JAQ07378.1    GBYB01002483    JAG72250.1    GL887695    EGI70414.1    GL447283    EFN86604.1    EFN62239.1    KQ980903    KYN11612.1    JRES01001250    KNC24227.1    GEDC01006523    JAS30775.1    GEDC01010770    JAS26528.1    KQ982576    KYQ54647.1    GEDC01021312    JAS15986.1    KQ978379    KYM94471.1    KQ981905    KYN33349.1    NNAY01003198    OXU19820.1    UFQS01000040    UFQT01000040    SSW98155.1    SSX18541.1    GL440368    EFN65993.1   
Pfam
PF07993   NAD_binding_4        + More
PF03015   Sterile
Interpro
IPR026055   FAR        + More
IPR013120   Male_sterile_NAD-bd       
IPR036291   NAD(P)-bd_dom_sf       
IPR033640   FAR_C       
SUPFAM
SSF51735   SSF51735       
PDB
4W4T     E-value=1.20338e-09,     Score=149

Ontologies

Topology

Length:
271
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.18086
Exp number, first 60 AAs:
0.18079
Total prob of N-in:
0.01401
outside
1  -  271
 
 

Population Genetic Test Statistics

Pi
3.549399
Theta
4.484745
Tajima's D
-1.26905
CLR
1.392019
CSRT
0.0896955152242388
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号