SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO14199
Pre Gene Modal
BGIBMGA011140
Annotation
PREDICTED:_fatty_acyl-CoA_reductase_1-like_[Bombyx_mori]
Full name
Fatty acyl-CoA reductase      
Location in the cell
PlasmaMembrane   Reliability : 3.037
 

Sequence

CDS
ATGGACAGCGCTTTAGCGTTGGAGATCGAGCAGGTCTCGCGTCAGAAGGCGCTGGAGGAGGAAGCGCTCCGCGGCGAGTCGGCTGTGCGGCAGTTCTACGCGGGAACCACAGCGCTGATCACTGGAGGCACGGGCTTCATCGGGAAACAACTCATAGAGAAGCTTCTAAGATCGTGCGATGTTAAGCGGATTTACATATTGATACGATCGAAAAAGGGACTGTCTATGGAAGAAAGGCTCCAGTTACAATTTAAAGATCCTGTATACGACAATTTACGGTCTCAACAACCAGATTTCGCTCGGAAAGTGATACCGGTCGAAGGCGACATCTCAGAACTAGGCGTCGGCCTGAACAACGAAGACAGAATGAAGCTTGCGCAAGAGGCGAATGTGATATTCCACGTGGCCGCCACGACCAAGTTCGAAGAGCCACTAAAGAAGGCCACATTCATTAACGTCAGAGGAACCAGGGAGATCCTTGAATTGGCCAAATGCTGCAAAAATCTAAGATCCTTCGTACACGTGTCAACTGCGTTCTTCAATGCAACAAAGAGCAGAATAAATCACACCATCGAGGAGAAATTCTATGAAAGCCCTGTCCCTCCGGAAGTCATGATACAACTCGCGGAGACAGTTGAAGAATGCAGACTCAACGCGATCACTGCTGATTTGATAAGGGACTGGCCCAACACGTACTGCTTCACGAAGGCCATAGCGGAGGATGTCGTGCGTACAATGGGCAAGGCTTTACCTGTGGCCATAGTGAGGCCACCCGTAGTTGTCTGCACGCTCAATGAACCCACACCTGGATGGGTGGATATGAGCTCGGTGATTGGTCCCAGCGGGATTATTTTAGGCGTAGGCCTTGGCGTGACGCATGTGGTTTTAATAGGTGAAATAATGATAGCGATAGCTCCTGTGGACTACGTCAACAACACTGTATTGGCGACAGCGTGGGAAACCGACAAACGTTTTAAAAATAATGAAAAAGAGTCTAAGATTTACAATATAAGCAACTCCAGATGCACACTTGAGAAAAATCTTTTGTGCGATGTCCTGAAAAATCCTAACACAAAACAGTACGCTACGCCGAAAGCCGTTTGGTACTGTTATGGTTTTGAGACCGGAAGCGATGTTGTATTCTGGTTGTTAACATGGCTGCTGCATTACATACCTGCGTATGTAGCCGACTTCGTGTTTAATGTGACCTCCATGAAGCGTCCTGAGGGCATAAAGTCATTCGTTAAAATGTATGAAAAGATATACAAAATGTCTTTGTTGTACGGCTATTTCCTGAGGAACCAGTGGAATTTTGTCGATGACAACACCGTGGCCATGTTGAACCAAATGTCAAAAACTGACAGGATATTGTTCAATTTTGACATTTCGAAGATCGATTGGCCGCACTATATGCTGATCTGGTGCATCGGCTTGAGAAAGTTCATCGTGAAAGACGGACTCAAAGACAGCGACTATGGAATGAAGAAACAGAGATGGCTGAAGATAGCGCACATTAGTTTTTATACGCTGTTCTTTGGAGTCGTGTTTTCTTTGTTATATCTCGCCTGTAGAATTTTTATGTCTGTAATTTGA
Protein
MDSALALEIEQVSRQKALEEEALRGESAVRQFYAGTTALITGGTGFIGKQLIEKLLRSCDVKRIYILIRSKKGLSMEERLQLQFKDPVYDNLRSQQPDFARKVIPVEGDISELGVGLNNEDRMKLAQEANVIFHVAATTKFEEPLKKATFINVRGTREILELAKCCKNLRSFVHVSTAFFNATKSRINHTIEEKFYESPVPPEVMIQLAETVEECRLNAITADLIRDWPNTYCFTKAIAEDVVRTMGKALPVAIVRPPVVVCTLNEPTPGWVDMSSVIGPSGIILGVGLGVTHVVLIGEIMIAIAPVDYVNNTVLATAWETDKRFKNNEKESKIYNISNSRCTLEKNLLCDVLKNPNTKQYATPKAVWYCYGFETGSDVVFWLLTWLLHYIPAYVADFVFNVTSMKRPEGIKSFVKMYEKIYKMSLLYGYFLRNQWNFVDDNTVAMLNQMSKTDRILFNFDISKIDWPHYMLIWCIGLRKFIVKDGLKDSDYGMKKQRWLKIAHISFYTLFFGVVFSLLYLACRIFMSVI

Summary

Description
Catalyzes the reduction of fatty acyl-CoA to fatty alcohols.
Catalytic Activity
a long-chain fatty acyl-CoA + 2 H(+) + 2 NADPH = a long-chain primary fatty alcohol + CoA + 2 NADP(+)
Similarity
Belongs to the fatty acyl-CoA reductase family.
Feature
chain  Fatty acyl-CoA reductase
EC Number
1.2.1.84
EMBL
BABH01042202    BABH01042203    BABH01042204    BABH01035129    BABH01035130    BABH01035131    + More
BABH01035132    NWSH01000368    PCG76936.1    NWSH01000263    PCG77899.1    MF687542    ATJ44468.1    KZ150147    PZC72871.1    KZ149959    PZC76396.1    ODYU01004617    SOQ44684.1    KZ150217    PZC72127.1    PZC72129.1    PZC76395.1    KT261699    ALJ30239.1    KQ460036    KPJ18429.1    PCG76937.1    NWSH01003107    PCG66934.1    PZC72126.1    AGBW02013183    OWR43905.1    ODYU01010853    SOQ56210.1    KQ459593    KPI96441.1    KPI96440.1    KQ460890    KPJ10851.1    PZC72128.1    PCG77898.1    PCG76935.1    NWSH01000230    PCG78176.1    NWSH01001490    PCG71095.1    KT261695    ALJ30235.1    KU755476    ARD71186.1    AGBW02011118    OWR47192.1    BABH01035163    BABH01035164    PZC72130.1    KP237913    MF687534    AKD01766.1    ATJ44460.1    KP237926    MF687596    AKD01779.1    ATJ44522.1    KJ622061    AID66649.1    KPI96403.1    KPI96442.1    KB632003    ERL87876.1    APGK01044237    APGK01044238    KB741021    ENN75098.1    GU808251    ADI82775.1    KJ622062    AID66650.1    GBHO01025676    JAG17928.1    GDHC01012276    JAQ06353.1    GEDC01021312    JAS15986.1    GEDC01010770    JAS26528.1    KU755485    ARD71195.1    KPJ18430.1    GGMS01011572    MBY80775.1    GFXV01007576    MBW19381.1    KQ435694    KOX80980.1    NEVH01011924    PNF31087.1    AJWK01024997    AJWK01024998    AJWK01024999    GGMR01018223    MBY30842.1    KQ976417    KYM89582.1    KT261704    ALJ30244.1    ABLF02017921    KQ982194    KYQ59115.1    PZC76399.1    GGMS01010440    MBY79643.1    GEZM01028194    GEZM01028193    JAV86394.1    KQ460152    KPJ17348.1    PCG77902.1    KQ776822    OAD52165.1    GFXV01002241    MBW14046.1    MG573160    AWJ25022.1    KP237938    MF687591    AKD01791.1    ATJ44517.1    ADTU01015701    ADTU01015702    KQ976870    KYN07801.1    UFQS01001285    UFQT01001285    SSX10116.1    SSX29838.1    GEZM01093770    JAV56139.1    GEYN01000141    JAV01988.1    KQ980903    KYN11612.1    GEBQ01030984    JAT08993.1    GEBQ01025216    JAT14761.1    MG573167    AWJ25029.1    REGN01004851    RNA15897.1    CVRI01000054    CRL00357.1    GL887695    EGI70414.1    KQ982576    KYQ54647.1    KQ981905    KYN33349.1    GECU01024246    JAS83460.1    GEZM01061226    JAV70627.1    KPI96377.1    DS235060    EEB11148.1    GFXV01004402    MBW16207.1    GL443286    EFN62238.1    NEVH01009426    PNF32977.1    EFN62239.1    KQ978379    KYM94471.1    GECU01016929    JAS90777.1    ABLF02017029    ABLF02017919    ABLF02017920    GECZ01027740    JAS42029.1   
Pfam
PF03015   Sterile        + More
PF07993   NAD_binding_4
PF02535   Zip
Interpro
IPR036291   NAD(P)-bd_dom_sf        + More
IPR013120   Male_sterile_NAD-bd       
IPR033640   FAR_C       
IPR026055   FAR       
IPR003689   ZIP       
SUPFAM
SSF51735   SSF51735       
PDB
4W4T     E-value=2.69697e-10,     Score=158

Ontologies

Topology

Length:
530
Number of predicted TMHs:
3
Exp number of AAs in TMHs:
70.19104
Exp number, first 60 AAs:
3.96231
Total prob of N-in:
0.37615
inside
1  -  282
TMhelix
283  -  305
outside
306  -  379
TMhelix
380  -  402
inside
403  -  503
TMhelix
504  -  526
outside
527  -  530
 
 

Population Genetic Test Statistics

Pi
2.132505
Theta
2.310419
Tajima's D
-1.300549
CLR
1.747697
CSRT
0.0787460626968652
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号