SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO14118
Annotation
AF461149_1_transposase_[Bombyx_mori]
Full name
Signal transducer and activator of transcription      
Location in the cell
Cytoplasmic   Reliability : 1.222 Mitochondrial   Reliability : 1.294 Nuclear   Reliability : 1.663
 

Sequence

CDS
ATGTTCAATAACAGGCACTCGGTATTCCAACAAGATTCGGCGCCAGCTCATAGAGCGAAGAGCACACAAGACTGGCTGGCGGCGCGTGAAATCGACTTCATCCGGCACGAAGACTGGCCCTCCTCCAGTCCAGATTTGAATCCGTTAGATTACAAGATATGGCAACACTTGGAGGAAAAGGCGTGCTCAAAGCCTCATCCCAATTTGGAGTCACTCAAGACATCCTTGATTAAGGCAGCCGCCGATATTGACATGGACCTCGTTCGTGCTGCGATAGACGACTGGCCGCGCAGATTGAAGGCCTGTATTCAAAATCACGGAGATCGTTTTGAATAA
Protein
MFNNRHSVFQQDSAPAHRAKSTQDWLAAREIDFIRHEDWPSSSPDLNPLDYKIWQHLEEKACSKPHPNLESLKTSLIKAAADIDMDLVRAAIDDWPRRLKACIQNHGDRFE

Summary

Similarity
Belongs to the TGF-beta family.
Belongs to the transcription factor STAT family.
EMBL
AF461149    AAN06610.1    AB363028    BAG15927.1    AB473770    BAH20555.1    + More
AB363006    AB363010    AB363014    BAG15923.1    BAG15924.1    AB363018    BAG15926.1    RSAL01000021    RVE52408.1    RSAL01000012    RVE53510.1    RSAL01000114    RVE46946.1    RSAL01000931    RVE41042.1    RSAL01000063    RVE49524.1    RSAL01000300    RVE42771.1    RSAL01000140    RVE46091.1    RSAL01000387    RVE42024.1    RSAL01000174    RVE45058.1    RSAL01000131    RVE46422.1    RSAL01000209    RVE44259.1    RSAL01000004    RVE54604.1    RSAL01000022    RVE52367.1    RSAL01000470    RVE41612.1    RSAL01000200    RVE44486.1    U47917    AAB47739.1    UYSL01020634    VDL75527.1    LNIX01000030    OXA41211.1    UYSL01022144    VDL79905.1    UYSL01002425    VDL65835.1    UYSL01023059    VDL81638.1    KI662043    ETN73029.1    JF779677    AEO90418.1    UYSL01009772    VDL68385.1    PDUG01000005    PIC23776.1    DS268612    EFO94085.1    UYSL01020109    VDL72812.1    JARK01001337    EYC34439.1    PDUG01000006    PIC20538.1    CAVP010058755    CDL95145.1    JARK01001658    EYB84158.1    DS268539    EFO88027.1    DS268433    EFO97645.1    UYSL01020934    VDL76658.1    DS268747    EFP00909.1    JARK01001601    EYB87313.1    DS268420    EFO87874.1    UYSL01020631    VDL75518.1    PIC29926.1    UYSL01019770    VDL69590.1    PDUG01000001    PIC51673.1    UYSL01019810    VDL70150.1    UYSL01021399    VDL78127.1    JARK01000255    EYC39473.1    JARK01001471    EYB97976.1    PDUG01000012    PIC13506.1    DS268492    EFP11689.1    KN729202    KIH62598.1    UYSL01019905    VDL71189.1    EFP11674.1    RSAL01000110    RVE47159.1    PDUG01000004    PIC32571.1    DS268565    EFO90304.1    DS268508    EFO83264.1    DS268606    EFO93488.1    DS268428    EFO94379.1    DS268466    EFP06959.1    JARK01001411    EYC06502.1    DS268421    EFO88618.1    DS268673    EFO98001.1    DS268679    EFO98285.1    HE601413    CAS00486.1    DS268525    EFO85497.1    UZAH01001595    VDO19836.1    JOJR01000015    RCN51257.1    UZAH01031030    VDP13493.1    UYSL01023743    VDL82626.1    PIC28734.1    JOJR01000583    RCN36166.1    UZAH01026445    VDO80847.1    DS268545    EFO88382.1    UYSL01022000    VDL79615.1    KN726559    KIH67820.1    PIC32570.1   
Pfam
PF00019   TGF_beta        + More
PF00431   CUB
PF07776   zf-AD
PF16095   COR
PF00069   Pkinase
PF00722   Glyco_hydro_16
PF01017   STAT_alpha
PF02864   STAT_bind
PF00017   SH2
PF02865   STAT_int
PF13358   DDE_3
PF00292   PAX
PF00083   Sugar_tr
PF00520   Ion_trans
PF00250   Forkhead
Interpro
IPR009057   Homeobox-like_sf        + More
IPR001839   TGF-b_C       
IPR029034   Cystine-knot_cytokine       
IPR017948   TGFb_CS       
IPR015615   TGF-beta-rel       
IPR000859   CUB_dom       
IPR035914   Sperma_CUB_dom_sf       
IPR012934   Znf_AD       
IPR032171   COR       
IPR020859   ROC_dom       
IPR000719   Prot_kinase_dom       
IPR011047   Quinoprotein_ADH-like_supfam       
IPR011009   Kinase-like_dom_sf       
IPR008271   Ser/Thr_kinase_AS       
IPR027417   P-loop_NTPase       
IPR000757   GH16       
IPR013320   ConA-like_dom_sf       
IPR012345   STAT_TF_DNA-bd_N       
IPR008967   p53-like_TF_DNA-bd       
IPR013799   STAT_TF_prot_interaction       
IPR013800   STAT_TF_alpha       
IPR013801   STAT_TF_DNA-bd       
IPR000980   SH2       
IPR015988   STAT_TF_coiled-coil       
IPR001217   STAT       
IPR036535   STAT_N_sf       
IPR036860   SH2_dom_sf       
IPR038717   Tc1-like_DDE_dom       
IPR001523   Paired_dom       
IPR036388   WH-like_DNA-bd_sf       
IPR036906   ATPase_V1_fsu_sf       
IPR036259   MFS_trans_sf       
IPR020846   MFS_dom       
IPR005828   MFS_sugar_transport-like       
IPR005821   Ion_trans_dom       
IPR024862   TRPV       
IPR036390   WH_DNA-bd_sf       
IPR001766   Fork_head_dom       
IPR030456   TF_fork_head_CS_2       
SUPFAM
SSF46689   SSF46689        + More
SSF57501   SSF57501       
SSF49854   SSF49854       
SSF56112   SSF56112       
SSF52540   SSF52540       
SSF50998   SSF50998       
SSF49899   SSF49899       
SSF48092   SSF48092       
SSF47655   SSF47655       
SSF49417   SSF49417       
SSF55550   SSF55550       
SSF103473   SSF103473       
SSF46785   SSF46785       
PDB
5CR4     E-value=1.84621e-07,     Score=125

Ontologies

Topology

Subcellular location
Secreted  
Cytoplasm  
Nucleus  
Length:
111
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0
Exp number, first 60 AAs:
0
Total prob of N-in:
0.27512
outside
1  -  111
 
 

Population Genetic Test Statistics

Pi
131.19315
Theta
61.083984
Tajima's D
3.513441
CLR
0
CSRT
0.994800259987001
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号