SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO14081
Pre Gene Modal
BGIBMGA013783
Annotation
AF461149_1_transposase_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 2.572
 

Sequence

CDS
ATGGAGTGGACGCTTAAAGAAGACCGTGTTGCAGTTATTGCGTTGCATCGTTGTGGTTACGCGCCAATTCAAATTTTTAACATACTGAAAAATTTTTATATAACCAAAAGATTCGTTTATCGTACCTTCAAACGATACAATGAAGACTCTAGTGTAGATGACAGGTCTGTTAGGACTCCAGCAGTGATAAAAGCTGTGAAGGCGCGAATTCAAAGAAATCCCAAACGCACTGGGTATTCCAACAAGATTCGGCACCAGCTCATAGAGCAAAGAGCACACAAGACTGGCTGGCGTGAAATCGACTTCATCCGGCACGAAGACTGGCCCTCCTCCAGTCCAGATTTGAATCCGTTAGATTACAAGATATGGCAACACTTGGAGGAAAAGGCGTGTTCAAAGCCTCATCCCAATTTGGAGTCACTCAAGACATCCTTGATTAAGGCAGCCGCCGATATTAACATGGACCTCGTTCGTGCTGCGATAGACGACAGGCCGCGCAGATTGAAGGCCTGTATTCAAAATCACGGAGGTCATTTTGAATAA
Protein
MEWTLKEDRVAVIALHRCGYAPIQIFNILKNFYITKRFVYRTFKRYNEDSSVDDRSVRTPAVIKAVKARIQRNPKRTGYSNKIRHQLIEQRAHKTGWREIDFIRHEDWPSSSPDLNPLDYKIWQHLEEKACSKPHPNLESLKTSLIKAAADINMDLVRAAIDDRPRRLKACIQNHGGHFE

Summary

Pfam
PF07776   zf-AD        + More
PF00431   CUB
PF13358   DDE_3
Interpro
IPR009057   Homeobox-like_sf        + More
IPR012934   Znf_AD       
IPR000859   CUB_dom       
IPR035914   Sperma_CUB_dom_sf       
IPR038717   Tc1-like_DDE_dom       
IPR036388   WH-like_DNA-bd_sf       
SUPFAM
SSF46689   SSF46689        + More
SSF49854   SSF49854       
Gene 3D
PDB
5CR4     E-value=0.00724946,     Score=88

Ontologies

Topology

Length:
180
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
7.10087
Exp number, first 60 AAs:
7.10087
Total prob of N-in:
0.26107
outside
1  -  180
 
 

Population Genetic Test Statistics

Pi
138.307707
Theta
63.086891
Tajima's D
2.270833
CLR
0.277156
CSRT
0.919454027298635
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号