SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO14065
Pre Gene Modal
BGIBMGA011226
Annotation
mfs_transporter_[Papilio_xuthus]
Location in the cell
PlasmaMembrane   Reliability : 2.861
 

Sequence

CDS
ATGCAGTACGCAGCCGAGATTCTGCCCACCGTCGTGAGAGCTCAGGGCCTAGCTCTGATACACATCACTGGATATGTTGCAACAATACTGGTGCCGTACATCGTATATTTGGCAACCATTGCGACCGAAATACCCCTTCTAATATTAGGCACTGTGGGCATAATTGGTGGAATTTTATGCCTCTTTCTACCGGAATCGATGGGCAAAGAAATGCCTCAAACTCTTCAGGATGGAGAAGAGTATGGGTTGGAGCAGAAGTTCTGGGATTTTCCGTGCTGCACCAGGTGGGTTAGCCAAGACTCGGGTCTGCTATCATAG
Protein
MQYAAEILPTVVRAQGLALIHITGYVATILVPYIVYLATIATEIPLLILGTVGIIGGILCLFLPESMGKEMPQTLQDGEEYGLEQKFWDFPCCTRWVSQDSGLLS

Summary

EMBL
BABH01009800    BABH01009801    ODYU01004909    SOQ45269.1    AK403928    BAM20038.1    + More
RSAL01000031    RVE51608.1    KQ459875    KPJ19681.1    AGBW02009123    OWR51601.1    KQ459593    KPI96288.1    KZ150153    PZC72816.1    LJIG01000424    KRT86516.1    KQ971321    EFA00687.1    GEDC01023768    JAS13530.1    NEVH01007822    PNF35272.1    BABH01009804    BABH01009805    KPI96286.1    KPJ19680.1    NWSH01000178    PCG78709.1    CVRI01000042    CRK95636.1    KK852417    KDR24330.1    KB632387    ERL94366.1    AJVK01015236    AJWK01023693    GECU01023907    JAS83799.1    PZC72815.1    GEZM01052731    JAV74290.1    APGK01053700    APGK01053701    KB741231    ENN72266.1    CH477848    EAT35660.1    GFDF01009490    JAV04594.1    ODYU01007620    SOQ50550.1    KQ434878    KZC09853.1    JXUM01026950    JXUM01026951    JXUM01026952    JXUM01026953    KQ560772    KXJ80949.1    GDUN01000921    JAN94998.1    CH477981    EAT34641.1    GFTR01007453    JAW08973.1    KZ288416    PBC26059.1    GECL01001415    JAP04709.1    JRES01000930    KNC27191.1    GBBI01004623    JAC14089.1    ACPB03009635    ACPB03009636    ACPB03009637    ACPB03009638    ACPB03009639    LBMM01008789    KMQ88639.1    DS235184    EEB13063.1    UFQS01000037    UFQT01000037    SSW98016.1    SSX18402.1    SSW98015.1    SSX18401.1    GEBQ01024996    JAT14981.1    JXUM01062362    KQ562196    KXJ76434.1    GAKP01013673    JAC45279.1    KQ414596    KOC69917.1    GL447693    EFN86109.1    DS234836    EDS35332.1    GECZ01018651    JAS51118.1    APCN01002315    AAAB01008960    EAA11678.4    DS233035    EDS27656.1    KQ769818    OAD52819.1    NNAY01001101    OXU25136.1    GAMD01001231    JAB00360.1    AXCN02000878    ADMH02001954    ETN60286.1    CP012525    ALC43177.1    CH916366    EDV96762.1    AXCM01001383    GFDL01015640    JAV19405.1    GAMC01016162    JAB90393.1    GAKP01013667    JAC45285.1    ATLV01023587    KE525344    KFB49337.1    KK854453    PTY15970.1    GFDL01001826    JAV33219.1    JRES01001371    KNC23290.1    GAMC01016163    JAB90392.1    KA648236    AFP62865.1    JR047570    AEY60446.1    CCAG010010771    KK107419    QOIP01000003    EZA51081.1    RLU24986.1    GDIQ01186847    JAK64878.1    UFQT01000295    SSX22938.1    GBXI01001560    JAD12732.1    CH379069    EAL29580.3    OUUW01000009    SPP85099.1    KRT08150.1   
Pfam
PF00083   Sugar_tr        + More
PF07690   MFS_1
PF04389   Peptidase_M28
Interpro
IPR005828   MFS_sugar_transport-like        + More
IPR036259   MFS_trans_sf       
IPR020846   MFS_dom       
IPR005829   Sugar_transporter_CS       
IPR011701   MFS       
IPR007484   Peptidase_M28       
IPR037457   M28_QC       
SUPFAM
SSF103473   SSF103473       

Ontologies

Topology

Length:
105
Number of predicted TMHs:
2
Exp number of AAs in TMHs:
43.53148
Exp number, first 60 AAs:
39.47587
Total prob of N-in:
0.49530
POSSIBLE N-term signal
sequence
inside
1  -  16
TMhelix
17  -  39
outside
40  -  43
TMhelix
44  -  63
inside
64  -  105
 
 

Population Genetic Test Statistics

Pi
286.344285
Theta
144.739838
Tajima's D
3.158828
CLR
0.118604
CSRT
0.985250737463127
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号