SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO14009  Validated by peptides from experiments
Pre Gene Modal
BGIBMGA004873
Annotation
PREDICTED:_polyribonucleotide_nucleotidyltransferase_1?_mitochondrial-like_[Bombyx_mori]
Location in the cell
Cytoplasmic   Reliability : 2.983
 

Sequence

CDS
ATGTCAAAGCCATTCGATCCTTCTCAGGGCATAGAAGACTACATGGGCGATATGGACTTCAAAGTGGCCGGCACGAAGAAGGGCATCACGGCGCTGCAGGCGGACATCAAGCTGGCCGGCCTGCCGCTCCGCGTCGTCATGGAGGCCGTGCAGCGGGCCTGCGACGCCAATGCCAAGATCATCGACATTATGAACCAATGCCTCGACGCACCCAGACAAGGATTAAAAGAGAACATGCCAGTGATTGAAGAGATCGAAGTGGAAGCTCACAAGCGGCCCAAGCTCCTCGGGCTCGGCGGCTCCAACTTGAAGAAGCTCTACGTTGAGACCGGCGTGCAGGTAAGACATCTAGACTATTAA
Protein
MSKPFDPSQGIEDYMGDMDFKVAGTKKGITALQADIKLAGLPLRVVMEAVQRACDANAKIIDIMNQCLDAPRQGLKENMPVIEEIEVEAHKRPKLLGLGGSNLKKLYVETGVQVRHLDY

Summary

EMBL
BABH01025198    BABH01025199    BABH01025200    BABH01025201    KZ150371    PZC71144.1    + More
ODYU01009033    SOQ53144.1    NWSH01000577    PCG75543.1    PCG75542.1    AGBW02000220    OWR55807.1    KQ460205    KPJ16795.1    NEVH01024531    PNF16934.1    KQ971351    EFA06447.1    APGK01045628    KB741037    KB632319    ENN74666.1    ERL92290.1    PNF16930.1    KK853697    KDQ96253.1    LJIG01009785    KRT82386.1    PNF16932.1    GEBQ01019427    JAT20550.1    UFQT01000509    SSX24854.1    GEZM01036370    JAV82757.1    PNF16933.1    GEZM01036371    JAV82756.1    LNIX01000002    OXA59195.1    GDIP01187468    JAJ35934.1    GEBQ01009055    JAT30922.1    GL732546    EFX80827.1    GBRD01006584    JAG59237.1    GBHO01044672    GDHC01009054    JAF98931.1    JAQ09575.1    JSUE03010920    JSUE03010921    JSUE03010922    GDIP01125037    JAL78677.1    BDGG01000004    GAU98331.1    GDIP01142071    JAL61643.1    GFJQ02001037    JAW05933.1    KK107238    EZA54837.1    GECU01034053    JAS73653.1    GBBM01000661    JAC34757.1    GFWV01023145    MAA47872.1    GDIQ01132870    JAL18856.1    NNAY01003564    OXU19193.1    GEDC01017707    JAS19591.1    GEZM01036372    JAV82755.1    GDIP01217174    JAJ06228.1    GDIP01159182    JAJ64220.1    JO842301    AEO33918.1    GDIP01050745    LRGB01000704    JAM52970.1    KZS16503.1    GDIP01015966    JAM87749.1    GECZ01012206    JAS57563.1    KK854443    PTY15892.1    GDIP01212721    JAJ10681.1    GDIQ01148270    JAL03456.1    GDIQ01220148    JAK31577.1    ATLV01005272    ATLV01005273    KE524276    KFB35183.1    GGLE01000358    MBY04484.1    CVRI01000070    CRL07195.1    QOIP01000007    RLU20809.1    GEFH01000410    JAP68171.1    GEDV01005182    JAP83375.1    GEFM01002883    JAP72913.1    GANP01004130    JAB80338.1    GFPF01010704    MAA21850.1    GCES01071417    JAR14906.1    JP015784    AES04382.1    GCES01164674    JAQ21648.1    GCES01164673    JAQ21649.1    GCES01164672    JAQ21650.1    GBYX01453275    JAO28240.1    AJVK01033652    GCES01164675    JAQ21647.1    GCES01071416    JAR14907.1   
Pfam
PF01138   RNase_PH        + More
PF03725   RNase_PH_C
PF03726   PNPase
PF00013   KH_1
PF13393   tRNA-synt_His
PF12745   HGTP_anticodon2
PF00575   S1
Interpro
IPR036612   KH_dom_type_1_sf        + More
IPR027408   PNPase/RNase_PH_dom_sf       
IPR012162   PNPase       
IPR012340   NA-bd_OB-fold       
IPR015848   PNPase_PH_RNA-bd_bac/org-type       
IPR001247   ExoRNase_PH_dom1       
IPR015847   ExoRNase_PH_dom2       
IPR036345   ExoRNase_PH_dom2_sf       
IPR003029   S1_domain       
IPR020568   Ribosomal_S5_D2-typ_fold       
IPR004087   KH_dom       
IPR036456   PNPase_PH_RNA-bd_sf       
IPR004088   KH_dom_type_1       
IPR036621   Anticodon-bd_dom_sf       
IPR041715   HisRS-like_core       
IPR024435   HisRS-related_dom       
IPR022967   S1_dom       
SUPFAM
SSF50249   SSF50249        + More
SSF55666   SSF55666       
SSF54791   SSF54791       
SSF54211   SSF54211       
SSF46915   SSF46915       
Gene 3D
PDB
3U1K     E-value=7.94156e-25,     Score=275

Ontologies

Topology

Length:
119
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.01174
Exp number, first 60 AAs:
0.01174
Total prob of N-in:
0.07826
outside
1  -  119
 
 

Population Genetic Test Statistics

Pi
324.262413
Theta
243.65672
Tajima's D
0.923642
CLR
1047.677727
CSRT
0.638618069096545
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号