SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO13981
Annotation
PREDICTED:_uncharacterized_protein_LOC101747137_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 2.892
 

Sequence

CDS
ATGTTGAAAATAAGCACTGAGGGGGAGCTGCACACGTTCACCGACGCCAGCGAGAAGGCCTACGCGTGTACAGTCTATTGGCGTCAAAAGACAGACGAGAGCACCTACCGCGTCACGCTTCTAGCAGGGAAAGCCAGGGTGACCCCACTGAGACCAGTCTCCATCCCAAGGTTGGAGCTGCAAGCTGCGCTGCTGGGGACAAGGATGGCGCAGGCGATAGCGGACGAATTGGACATCGCGGTCTGCAGAAGGACGTATTGGACTGACTCCAGTACAGTCCTGACATGGATAAAGACCGACCCACGCACGTTCAAACCTTTCGTTGCGCACCGACTCGCCGAGATAGAAGAGTCAACGAAGCCCCAAGAATGGCGATGGGTGCCTGGCTCGCAAAACCCAGCAGACGACGCAACTAGAGAGGCGCCGGCGGATTTCGACCACACGCATCGGTGGTTTAATGGACCCGAGTTCCTGACGTGGGATGAATCGCGCCGGCCCAAGCCGCGAACATTCAAGCAAGAACCGTCTGGAGAAGAGAAAGAGGCCTTCCTGGTCGCCACGGCGAGGACCGCTGACGCTAGACCCACGCCCGATCCGCACAGATTCTCGAGCTGGGTCAAGTTATTGAGAGCAACAGCCAGGGTCCTCCAATTTATCGAGCTGTGTCGACCCCGGAAGGAGAGCGCCTGCGTGTCCAGACAATTGGAGCAGCAAGATCCCACGTGGAGGACGACGCGAGCGAAGCAGCCCCGATCAACATGGAAGATAAGGACTCCAGAAGCACCTACAGAAGCGTGGCTGCCGCTCGATCCGCCCCACTTGAAGAAGGCGGAGAAGATCCTACTGAGAAGCAGCCAAGGAGAGAGCTTCGGTGAAAAAGATCCCGAACGTCACCCCAAGTTGCGACGGCTCGACGTCGTGATGGAAGATGGCCTGTTGCGCCTGCGCGGACGTATCGACGCAGCGCAATACATAGATGCAGGCTGCAAGCGACCGATCGTGCTGGACGGGAAGCACGTGATAGCGAGATTATTGATCAAACACTATCACGAGGCGTTCCAGCACGGTAACCACGCAACGGTGATGAACGAGGTGCGGCAGCGCTACTGGATCCTAGGTCTAAGATCGATCATTCGAGCGACGGCCGTCCGATGCCAGTGAACGAGCGGCGGTCTGCTTAAGAGACCTGCCTCCAAGATGATCCTGCTGGTGCCTGCAACGAGCGACGAGCCCACGCCCATAGAGTCGCCACTACAAGGAGTCGGTGCTGCGCACGAGGGGGAGGATGTTGGCGACAGCGGCGTCGCCCCATAA
Protein
MLKISTEGELHTFTDASEKAYACTVYWRQKTDESTYRVTLLAGKARVTPLRPVSIPRLELQAALLGTRMAQAIADELDIAVCRRTYWTDSSTVLTWIKTDPRTFKPFVAHRLAEIEESTKPQEWRWVPGSQNPADDATREAPADFDHTHRWFNGPEFLTWDESRRPKPRTFKQEPSGEEKEAFLVATARTADARPTPDPHRFSSWVKLLRATARVLQFIELCRPRKESACVSRQLEQQDPTWRTTRAKQPRSTWKIRTPEAPTEAWLPLDPPHLKKAEKILLRSSQGESFGEKDPERHPKLRRLDVVMEDGLLRLRGRIDAAQYIDAGCKRPIVLDGKHVIARLLIKHYHEAFQHGNHATVMNEVRQRYWILGLRSIIRATAVRCQXTSGGLLKRPASKMILLVPATSDEPTPIESPLQGVGAAHEGEDVGDSGVAP

Summary

EMBL
AF530470    AAQ09229.1    AB042119    BAA95570.1    AB042118    BAA95569.1    + More
KQ459986    KPJ18861.1    RSAL01000375    RVE42106.1    NWSH01008670    PCG62455.1    AAZX01023278    LNIX01000004    OXA56382.1    LNIX01000003    OXA57597.1    LNIX01000039    OXA39294.1    LNIX01000007    OXA52015.1    LNIX01000019    OXA44812.1    OXA44855.1    LNIX01000015    OXA46575.1    JXUM01127084    KQ567147    KXJ69602.1    JTDY01001530    KOB73634.1    GEHC01000914    JAV46731.1    GAMC01017930    JAB88625.1    GAMC01020594    JAB85961.1    GAMC01020598    GAMC01020596    GAMC01020592    JAB85959.1    JXUM01013493    KQ560378    KXJ82704.1    GEHC01000967    JAV46678.1    LNIX01000018    OXA45362.1    GGFJ01001476    MBW50617.1    GGFJ01001462    MBW50603.1    GEHC01000913    JAV46732.1    GGFJ01000302    MBW49443.1    GEHC01000872    JAV46773.1    GGFJ01000218    MBW49359.1    GEHC01000947    JAV46698.1    GGFL01001842    MBW66020.1    GGFL01001682    MBW65860.1    GEZM01052587    JAV74399.1    JXUM01109099    KQ565290    KXJ71123.1    JXUM01136032    KQ568367    KXJ69026.1    GGFL01005193    MBW69371.1    JXUM01038372    KQ561162    KXJ79503.1    LNIX01000012    OXA48117.1    LN877231    CTR11689.1    JXUM01005879    KQ560203    KXJ83865.1    AB110069    BAD01590.1    BAD01589.1    OXA55408.1    JXUM01083542    KQ563383    KXJ73941.1    GEZM01052586    JAV74401.1    JXUM01111221    KQ565482    KXJ70922.1    APCN01002024    ODYU01003174    SOQ41584.1    LSMT01000075    PFX28896.1    GCES01110894    JAQ75428.1    GEHC01000945    JAV46700.1    GCES01111900    JAQ74422.1    GCES01134385    JAQ51937.1    GCES01140631    JAQ45691.1    OXA55241.1    GCES01132273    JAQ54049.1    GCES01103975    JAQ82347.1    AAGJ04142769    AAGJ04142770    GBYX01459357    JAO22202.1    LSMT01000554    PFX16342.1    GBYX01459355    JAO22204.1    MRZV01000348    PIK51982.1    AAGJ04001285    AAGJ04091218    GDIQ01114015    JAL37711.1    KQ460970    KPJ10166.1    GDIP01036233    JAM67482.1    GDIP01004568    JAM99147.1    KL367480    KFD71819.1    JXUM01151198    KQ571164    KXJ68235.1    GCES01097275    JAQ89047.1    LSMT01000016    PFX33015.1    AAGJ04005692    GDIQ01071585    JAN23152.1    GDIQ01143107    JAL08619.1    AAGJ04095911    GDIQ01071584    JAN23153.1    GDIQ01002920    JAN91817.1    GDIQ01002921    JAN91816.1    HAEJ01014775    SBS55232.1    GCES01097166    JAQ89156.1    AAGJ04008210    AAGJ04125735    AAGJ04146728    AAGJ04146729    JXUM01144298    KQ569759    KXJ68523.1    ABLF02013940    ABLF02036313    ABLF02066938    ABLF02066950    IAAA01051064    LAA11179.1   
Pfam
PF03564   DUF1759        + More
PF05380   Peptidase_A17
PF00665   rve
PF18701   DUF5641
PF17921   Integrase_H2C2
PF05585   DUF1758
PF01565   FAD_binding_4
PF09129   Chol_subst-bind
PF00628   PHD
PF00078   RVT_1
Interpro
IPR040676   DUF5641        + More
IPR036397   RNaseH_sf       
IPR005312   DUF1759       
IPR001584   Integrase_cat-core       
IPR008042   Retrotrans_Pao       
IPR012337   RNaseH-like_sf       
IPR041588   Integrase_H2C2       
IPR008737   Peptidase_asp_put       
IPR001995   Peptidase_A2_cat       
IPR001878   Znf_CCHC       
IPR006094   Oxid_FAD_bind_N       
IPR016166   FAD-bd_PCMH       
IPR016164   FAD-linked_Oxase-like_C       
IPR016170   Cytok_DH_C_sf       
IPR015213   Cholesterol_OX_subst-bd       
IPR036318   FAD-bd_PCMH-like_sf       
IPR016169   FAD-bd_PCMH_sub2       
IPR016167   FAD-bd_PCMH_sub1       
IPR011011   Znf_FYVE_PHD       
IPR013083   Znf_RING/FYVE/PHD       
IPR001965   Znf_PHD       
IPR019787   Znf_PHD-finger       
IPR019786   Zinc_finger_PHD-type_CS       
IPR000477   RT_dom       
IPR036875   Znf_CCHC_sf       
IPR000253   FHA_dom       
IPR002999   Tudor       
IPR001841   Znf_RING       
IPR021109   Peptidase_aspartic_dom_sf       
IPR001969   Aspartic_peptidase_AS       
SUPFAM
SSF53098   SSF53098        + More
SSF56176   SSF56176       
SSF55103   SSF55103       
SSF57903   SSF57903       
SSF57756   SSF57756       

Ontologies

Topology

Length:
437
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00064
Exp number, first 60 AAs:
0
Total prob of N-in:
0.00165
outside
1  -  437
 
 

Population Genetic Test Statistics

Pi
388.665127
Theta
215.229657
Tajima's D
2.929699
CLR
0
CSRT
0.974001299935003
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号