SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO13882  Validated by peptides from experiments
Pre Gene Modal
BGIBMGA011438
Annotation
glutathione_peroxidase_[Bombyx_mori]
Full name
Glutathione peroxidase       + More
Epoxide hydrolase      
Location in the cell
Cytoplasmic   Reliability : 2.832
 

Sequence

CDS
ATGACATCGAATCCGGATTATAAAGCTGCGACATCCATTCACGAATTTACAGTCAAAAACATTAAAGGTGAAGACGTGAAGCTGGATGTCTACAAAGGCCATGTTTGTATCATTGTGAATGTTGCTTCTCAGTGCGGCCTTACTGCGAACAATTACAAACAATTGAATGAGCTCTATGAACAATACGGAGAGAGCAAAGGTCTCCGCATTCTGGCTTTCCCTTGTAATCAGTTTGCTGGTCAAGAGCCTGGCAATCCAGAAGAGATAGTTTGCTTTGCCTCTGAGCGTAAAGTCAAATTCGATTTGTTTGAGAAAGTTGATGTCAATGGAGACAATGCCAGTCCACTGTGGAAGTATTTGAAGCATAAGCAAGGAGGCACCCTTGGTAGCTTCATCAAGTGGAACTTTACCAAGTTCATCATAAACAAGGATGGAGTTCCAGTTGAACGCCACGGCCCCAATACTGACCCGTTGGATTTGGTCAAATCACTTGAAAAATATTGGTGA
Protein
MTSNPDYKAATSIHEFTVKNIKGEDVKLDVYKGHVCIIVNVASQCGLTANNYKQLNELYEQYGESKGLRILAFPCNQFAGQEPGNPEEIVCFASERKVKFDLFEKVDVNGDNASPLWKYLKHKQGGTLGSFIKWNFTKFIINKDGVPVERHGPNTDPLDLVKSLEKYW

Summary

Description
Catalyzes juvenile hormone hydrolysis.
Catalytic Activity
1-(4-methoxyphenyl)-N-methyl-N-[(3-methyloxetan-3-yl)methyl]methanamine + H2O = 2-{[(4-methoxybenzyl)(methyl)amino]methyl}-2-methylpropane-1,3-diol
cis-stilbene oxide + H2O = (1R,2R)-hydrobenzoin
Similarity
Belongs to the glutathione peroxidase family.
Belongs to the peptidase S33 family.
Feature
chain  Glutathione peroxidase
EC Number
3.3.2.9
EMBL
BABH01015503    AB221014    BAE07196.1    KJ995802    AIN39485.1    ODYU01013068    + More
SOQ59740.1    NWSH01001408    PCG71345.1    JQ009330    AFC98365.1    PCG71346.1    GAIX01003566    JAA88994.1    RSAL01000081    RVE48557.1    KC966930    AHV85204.1    MG431818    AWX63641.1    KQ460205    KPJ17142.1    KQ459601    KPI94065.1    AK402091    BAM18713.1    NEVH01006994    PNF36074.1    PNF36072.1    NNAY01000305    OXU29338.1    KK852527    KDR22003.1    FX983171    BAV93789.1    MH024448    AZA04939.1    KQ976513    KYM82400.1    KQ971329    EFA01372.1    GL453666    EFN75696.1    AY329359    AAP93585.1    KQ982179    KYQ59278.1    KQ977642    KYN00899.1    AM492682    CAM34513.1    KQ981298    KYN43069.1    JR040745    AEY59272.1    GQ438844    KZ288203    ADG21870.1    PBC33389.1    GU207870    ACZ66012.1    EFA01370.1    FJ895870    FJ895871    ACP44070.1    GBYB01003426    JAG73193.1    JR040744    AEY59271.1    KQ979014    KYN26619.1    KK107347    QOIP01000007    EZA52230.1    RLU20107.1    GL761538    EFZ23176.1    KQ434977    KZC12880.1    GL437329    EFN70618.1    KQ414617    KOC68154.1    GBYB01012536    JAG82303.1    KQ435793    KOX74205.1    GEBQ01002832    JAT37145.1    APGK01008500    APGK01058242    BT126751    KB741288    KB737708    KB631818    AEE61713.1    ENN70635.1    ENN82954.1    ERL86536.1    GEZM01045098    JAV77920.1    GEZM01045097    JAV77921.1    GFTR01002851    JAW13575.1    AB872500    AB872502    BAO18465.1    GANO01002730    JAB57141.1    AB872501    BAO18464.1    GECL01003013    JAP03111.1    JQ762261    AFP50153.1    APGK01058333    KB632322    ENN70682.1    ERL92328.1    GAHY01001921    JAA75589.1    GBGD01003218    JAC85671.1    DS235748    EEB16263.1    CVRI01000063    CRL04878.1    GECZ01008622    JAS61147.1    ACPB03001635    GECZ01000582    JAS69187.1    BT126813    AEE61775.1    GEBQ01029042    JAT10935.1    GEBQ01027312    GEBQ01001381    JAT12665.1    JAT38596.1    GEBQ01015379    JAT24598.1    GFDF01000549    JAV13535.1    GECZ01021956    GECZ01017483    JAS47813.1    JAS52286.1    AJWK01031790    JTDY01000782    KOB75897.1    GECU01032205    GECU01024988    JAS75501.1    JAS82718.1    KQ460417    KPJ14867.1    GGMS01017321    MBY86524.1    AB872496    AB872499    BAO18461.1    UFQT01000433    SSX24258.1    SSX24255.1    SSX24259.1    SSX24256.1    KT261710    ALJ30250.1    GEMB01002580    JAS00609.1    KU755500    ARD71210.1    BABH01018608    KQ459588    KPI97739.1    ODYU01004100    SOQ43618.1    GGMR01009298    GGMR01017440    MBY21917.1    MBY30059.1    AB293556    BAH97090.1    KZ150476    PZC70740.1    AXCN02001376    GAMD01001627    JAA99963.1    GEZM01076785    JAV63655.1    GEZM01076784    JAV63656.1    KJ579233    AIN34709.1    AGBW02008912    OWR52199.1   
Pfam
PF00255   GSHPx        + More
PF01222   ERG4_ERG24
PF06441   EHN
Interpro
IPR029759   GPX_AS        + More
IPR036249   Thioredoxin-like_sf       
IPR000889   Glutathione_peroxidase       
IPR029760   GPX_CS       
IPR001171   Ergosterol_biosynth_ERG4_ERG24       
IPR010497   Epoxide_hydro_N       
IPR029058   AB_hydrolase       
IPR016292   Epoxide_hydrolase       
SUPFAM
SSF52833   SSF52833        + More
SSF53474   SSF53474       
Gene 3D
PDB
2OBI     E-value=9.79088e-48,     Score=474

Ontologies

Topology

Subcellular location
Endoplasmic reticulum membrane  
Length:
168
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.03655
Exp number, first 60 AAs:
0.03581
Total prob of N-in:
0.27477
outside
1  -  168
 
 

Population Genetic Test Statistics

Pi
279.696775
Theta
207.585811
Tajima's D
1.092151
CLR
0
CSRT
0.687315634218289
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Peptides ×
Source Sequence Identity Evalue
25044914 IIAFIQQSSDPQAAAIK 96.30 5e-15
27102218 QGGTIGSFIK 96.30 5e-15
28467696 IIAEYVQGR 96.30 5e-15
28556443 VDVNGDNASPLWK 100.00 0.004
28556443 VDVNGDNASPLWK 100.00 0.004
28556443 VDVNGDNASPLWK 100.00 0.004
28556443 VDVNGDNASPLWK 100.00 0.004
28556443 QGGTLGSFIK 100.00 0.004
28556443 QLNELYEQYGESK 100.00 0.004
28556443 HGPNTDPLDLVK 100.00 0.007
28556443 HGPNTDPLDLVK 100.00 0.007
28556443 HGPNTDPLDLVK 100.00 0.007
28556443 HGPNTDPLDLVK 100.00 0.007
28556443 AATSIHEFTVK 100.00 0.007
28556443 NPLQNADAAVTYWLTSGAPSQK 100.00 0.007
28556443 HGPNTDPLDLVK 100.00 0.021
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号