SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO13869
Pre Gene Modal
BGIBMGA002389
Annotation
PREDICTED:_mucin-2-like_[Amyelois_transitella]
Location in the cell
Nuclear   Reliability : 4.2
 

Sequence

CDS
ATGGTCCATGTCCCCAAAGCAAAGCGGACTAAATGGAACAAGAAGGCCAATGAACACATCCTGATTGGATACTCAGAGAGTACCAAAGGATACAGGTTGTACAATGTAAAAACAAAAAATATTACCACTAGCAGGGATGTTGTTATCATGGAGAAAATCAACGACACAGATATGATACAAGCAGTAGTGGAAGAAAAAGAAACTATTCCAAGTGAAGAAGGAATACAAAAATGTGCTGTGACAAGTGAAGATTCCACTTGTGACTCACTAAATAGCACATACATGACAGATGATGCTACATATGTACCAGATGATACCAGTACCACCAGCTCAGATGAATTCTGTGATAGTAAATCGAATCACAAGTCAGAAAATCTGCAGCCAATAATTAAGGTGGAAAAGAGGACTAGGAAGAAACCAGACTGGTATGGGTACAATAACATATGTCAGAGCAGTGAGGAGGTGGACGACAATCTTCTCACTTATGAGGATGTAATGAGAGGATCAGAACAAGAAGAATGGTCAAAAGCCATGAAAGAGGAAATACAATCTTTCCATCAGAATGATGCTTGGGAGTTAGTAGACAGACCCAGTGGTGAAAATATTGTGGCATGCAAATGGGTGTATAAAAAGAAACTTAACAGTGACAACTCAGTGAGATATAGGGCACGGAGTTAG
Protein
MVHVPKAKRTKWNKKANEHILIGYSESTKGYRLYNVKTKNITTSRDVVIMEKINDTDMIQAVVEEKETIPSEEGIQKCAVTSEDSTCDSLNSTYMTDDATYVPDDTSTTSSDEFCDSKSNHKSENLQPIIKVEKRTRKKPDWYGYNNICQSSEEVDDNLLTYEDVMRGSEQEEWSKAMKEEIQSFHQNDAWELVDRPSGENIVACKWVYKKKLNSDNSVRYRARS

Summary

EMBL
BABH01011079    BABH01011080    NWSH01002797    PCG67521.1    GALX01001351    JAB67115.1    + More
GEZM01011855    JAV93396.1    GEZM01011856    JAV93393.1    GEZM01082909    JAV61231.1    JXUM01079187    KQ563112    KXJ74446.1    GBHO01019780    JAG23824.1    GBHO01019781    JAG23823.1    GDHC01011760    JAQ06869.1    JXUM01025282    KQ560717    KXJ81160.1    KQ460297    KPJ16236.1    GGFL01001458    MBW65636.1    GAKP01004084    JAC54868.1    GGFL01001457    MBW65635.1    KA648745    AFP63374.1    GEZM01011857    JAV93390.1    GEZM01011859    JAV93384.1    JXUM01073804    KQ562795    KXJ75116.1    CM003607    KYP67664.1    KQ484186    KYP36645.1    KQ483417    KYP53032.1    KQ483702    KYP42748.1    JXUM01122375    KQ566597    KXJ69988.1    GEHC01000963    JAV46682.1    CM003604    KYP72625.1    NEVH01003760    PNF39996.1    NEVH01006721    PNF37343.1    NEVH01006980    PNF36330.1    NEVH01019375    PNF22597.1    PNF37230.1    PNF37231.1    NEVH01002725    PNF41351.1    JXUM01029822    KQ560865    KXJ80573.1    NKQK01000005    PSS29970.1    NEVH01021934    PNF19224.1    LBMM01004924    KMQ91985.1    LBMM01014433    KMQ85183.1    KQ484038    KYP38095.1    ASHM01002084    PNY07765.1    ABLF02023757    ABLF02028466    ABLF02059696    GEZM01017327    JAV90764.1    GDHC01004875    JAQ13754.1    KQ483722    KYP42321.1    NKQK01000002    PSS35035.1    GDHC01010945    JAQ07684.1    GEZM01017329    JAV90762.1    GEZM01017328    JAV90763.1    GBHO01033237    JAG10367.1    GBHO01016859    JAG26745.1    GBHO01043059    JAG00545.1    GBHO01033235    JAG10369.1    DF974079    GAU44848.1    JXUM01060983    KQ562129    KXJ76624.1    NKQK01000016    PSS08126.1    GALX01004861    JAB63605.1    OIVN01002345    SPD02856.1    NEVH01016296    PNF26014.1    KL367553    KFD64618.1    CM003610    KYP62383.1    OIVN01001656    SPC96275.1    OIVN01002828    SPD06754.1    JYDJ01000231    KRX39500.1    CM003613    KYP57183.1    GGFL01004951    MBW69129.1    KL367475    KFD72989.1    GBHO01008810    JAG34794.1    JYDM01000091    KRZ88014.1    KL367628    KFD61291.1    LBMM01005619    KMQ91367.1    JYDI01000006    KRY60373.1    LBMM01012480    KMQ86201.1    LBMM01012652    KMQ86074.1    GDUN01000695    JAN95224.1    KQ258279    KOM25686.1    NWSH01000816    PCG74073.1    AM467700    CAN72600.1    GEVK01019149    JAU33683.1    DNYX01000169    HBK83011.1    LXQA010039457    MCH99127.1    GGFM01000953    MBW21704.1    JYDL01000068    KRX18751.1    JYDO01000312    KRZ65659.1    DNYX01000353    HBK84078.1    LBMM01013184    KMQ85774.1    GGFM01000952    MBW21703.1    GGFL01005562    MBW69740.1    AM482665    CAN81839.1    LBMM01012645    KMQ86082.1    AC149291    AAT38758.1    GBHO01007301    JAG36303.1    LXQA010007518    MCH84877.1    LBMM01012492    KMQ86193.1    JYDN01000001    KRX68994.1    GEZM01013472    GEZM01013471    GEZM01013470    JAV92539.1   
Pfam
PF00098   zf-CCHC        + More
PF00665   rve
PF07727   RVT_2
PF13976   gag_pre-integrs
PF13961   DUF4219
Interpro
IPR039537   Retrotran_Ty1/copia-like        + More
IPR001584   Integrase_cat-core       
IPR036875   Znf_CCHC_sf       
IPR012337   RNaseH-like_sf       
IPR001878   Znf_CCHC       
IPR013103   RVT_2       
IPR025724   GAG-pre-integrase_dom       
IPR036397   RNaseH_sf       
IPR025314   DUF4219       
SUPFAM
SSF57756   SSF57756        + More
SSF53098   SSF53098       
Gene 3D

Ontologies

Topology

Length:
225
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.0005
Exp number, first 60 AAs:
0.0005
Total prob of N-in:
0.31397
outside
1  -  225
 
 

Population Genetic Test Statistics

Pi
78.001062
Theta
101.154842
Tajima's D
-0.717727
CLR
0.805029
CSRT
0.191690415479226
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号