SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO13863
Pre Gene Modal
BGIBMGA011443
Annotation
Arginine/serine-rich_protein_PNISR_[Papilio_machaon]
Location in the cell
Nuclear   Reliability : 3.189
 

Sequence

CDS
ATGCAAGGCATTGATAAAACGGACCCACCCCCCACAGACCCATTATTTCCTCAACCTACCTCAGTATGCAGAGTAGCCATAAAACTTCCTCCCTTCTGGCCTGATCGGCCTGCAATTTGGTTTGCTCAGGTAGAGGCACAATTCTCGAGTTCAGGCATCTCCGCTGACCTGACTAAATTTAACTACGTGATTGCTCAGTTAGATACCCGAGTTATTGGGGAGGTAGAGGACATTATTCTCCAACCACCACCTGAGGACAAATATGGTCGCCTCAAATCCGAGTTGATCCGTAGGTTGTCCACGTCTGAGGAGCAACGTGTCAGGCAACTTGTCAGTGATGTTGAGTTGGGTAACCGCCGTCCTTCGCAGTTTTTACGTTATCTTAGATCATTGGCAGGAAAAACCCTCACTGATGAAAATTTGCTTCGCCAGCTATGGATGCGTCGCCTCCCACAACATCTCCAAGCAATTTTGGCCGCCCAATCAGAACTCTCGCTGGACAAAGTCGCTGAGCTAGCGGACAAAATTTTAGAAGTTTCGCCTGTAGTGGAAAATGAAAATGTGCTGTACTTGGATGCGGCAAATCCAGGATATCCCACCCAGTGGGCCTTGAATCCAACGGCCTATCAAAATGTGGACTGCAGTGAAGTCGACTGGGCGGCATTGGCTCAGCAATGGATAGCTATGAAAGAAGCTGCTGCCATAGTGGCACCGGCGCCACCTCCACCCAAACTCGATGTAGAGGAAGGAGAAGCCCCCATGGAGGTGGAAAATACCGAAAACAACACCGATGTACAGTTGCCTCCAGGTGCAGAGTGGAACTCATCAACGAATTCCTGGGGCGGTTCATGGAATCAATGGGGATGGGGTTGGCCAGGTCATGGAGATCCAAAAGTTCCTTCCGAACCTACTTTACCTTTGATCGACGGGTTTCCCATGCAACCTGATGCAACTGGACCTTCCATATCAGGCTATACAACAGCAGCGGGGAGTGGACCTACATTTCAACATGGGTACTGGACAGCTCCACAAGCTGATCAACAAACATCAAATAGAAGTAATAGTCAAAATAGAGATAGAAGGTCAAAAAGCAAGAATAAAGAACACAATAAAACCAGAATTCCAAGGCCACAAAGAGATAAACCAGGAATAAATCCAGTTATTCCACCAGCTATGCCTGGCATTGGCATGCCGACGATTGATGCTGCAAAAAGAAGACAACTTCCAGCTTGGATAAGAGAAGGTAAATTGGTAATTCTTGAATAA
Protein
MQGIDKTDPPPTDPLFPQPTSVCRVAIKLPPFWPDRPAIWFAQVEAQFSSSGISADLTKFNYVIAQLDTRVIGEVEDIILQPPPEDKYGRLKSELIRRLSTSEEQRVRQLVSDVELGNRRPSQFLRYLRSLAGKTLTDENLLRQLWMRRLPQHLQAILAAQSELSLDKVAELADKILEVSPVVENENVLYLDAANPGYPTQWALNPTAYQNVDCSEVDWAALAQQWIAMKEAAAIVAPAPPPPKLDVEEGEAPMEVENTENNTDVQLPPGAEWNSSTNSWGGSWNQWGWGWPGHGDPKVPSEPTLPLIDGFPMQPDATGPSISGYTTAAGSGPTFQHGYWTAPQADQQTSNRSNSQNRDRRSKSKNKEHNKTRIPRPQRDKPGINPVIPPAMPGIGMPTIDAAKRRQLPAWIREGKLVILE

Summary

Uniprot
ProteinModelPortal

Ontologies

GO

Topology

Length:
421
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00256
Exp number, first 60 AAs:
0.00018
Total prob of N-in:
0.00485
outside
1  -  421
 
 

Population Genetic Test Statistics

Pi
32.65522
Theta
201.02784
Tajima's D
2.049843
CLR
0.162698
CSRT
0.889755512224389
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号