SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO13862
Pre Gene Modal
BGIBMGA011353
Annotation
PREDICTED:_ATP-dependent_DNA_helicase_PIF1-like_[Microplitis_demolitor]
Full name
ATP-dependent DNA helicase      
Location in the cell
Cytoplasmic   Reliability : 2.526
 

Sequence

CDS
ATGCTTCAAGATCCATCCGCTGAAACATTCTCTAAACAACTCTTAGATATCGGTGATGGAAAAGTCACTATAGCTGAAACTGGATACATAAAATTAGCGAATGATTTCTGCACTATCATTGATTCGCAAGATGCTCTCATTGAACAAATATTTCCCGATGTACACACGAATTACATAAATCTCGAGTGGCTTGCAGAAAGAGCAATGTTAGCTGCAAAAAATGTGGACGTTGACATTTTAAATCTGAAGATACAACAGTTAATGCCAGGGGACTTGGTATCATATAGATCTATTGATACAGTTTGCGATGGCACTGAAGCTGTAAATTTTCCAACAGAGTTTTTGAACTCACTGGATTTGCCAGGCATGCCGCCACATAACTTACAATTGAAGGTTGGATCTCCAATTATTTTGCTTCGTAATTTGAACCCGCCACGGCTATGA
Protein
MLQDPSAETFSKQLLDIGDGKVTIAETGYIKLANDFCTIIDSQDALIEQIFPDVHTNYINLEWLAERAMLAAKNVDVDILNLKIQQLMPGDLVSYRSIDTVCDGTEAVNFPTEFLNSLDLPGMPPHNLQLKVGSPIILLRNLNPPRL

Summary

Catalytic Activity
ATP + H2O = ADP + H(+) + phosphate
Cofactor
Mg(2+)
Similarity
Belongs to the helicase family.
Feature
chain  ATP-dependent DNA helicase
EC Number
3.6.4.12
EMBL
NKXS01013118    PIM96964.1    ABLF02032513    ABLF02032521    GAKP01013478    JAC45474.1    + More
GECU01024866    GECU01018275    GECU01015236    JAS82840.1    JAS89431.1    JAS92470.1    GEDC01007314    JAS29984.1    GEDC01024516    GEDC01006142    JAS12782.1    JAS31156.1    IAAA01055497    LAA11597.1    ODYU01006586    SOQ48558.1    GGFJ01008921    MBW58062.1    GGMR01007248    MBY19867.1    GGMR01003219    MBY15838.1    ABLF02039419    ABLF02041372    GGMS01012994    MBY82197.1    ABLF02033384    RSAL01001639    RVE40746.1    HACG01048798    CEK95663.1    ABLF02035713    GAKP01015355    JAC43597.1    ABLF02016188    GECZ01016647    JAS53122.1    ABLF02011512    ABLF02065998    LC056060    BAW33744.1    ABLF02021820    ABLF02026944    ABLF02065999    ABLF02030014    RSAL01000338    RVE42429.1    ABLF02016932    ABLF02018127    GAIX01013838    JAA78722.1    ABLF02015385    ABLF02015386    ABLF02056723    HQ009558    AEE09607.1    BABH01039432    GAKP01009346    JAC49606.1    JARK01001590    EYB87952.1    APGK01055334    KB741262    KB631831    ENN71556.1    ERL86591.1    NEVH01005285    PNF38967.1    ABLF02042290    KN736527    KIH55917.1    ABLF02008865    ABLF02060835    ABLF02016516    GGMS01013477    MBY82680.1    KE125929    EPB66767.1    GGMS01001243    MBY70446.1    KN777051    KIH44533.1    KN773623    KIH45171.1    KN739487    KIH54222.1    KN730017    KIH61566.1    KE126587    EPB66060.1    KN768033    KIH47189.1    KN776352    KIH44667.1    ABLF02006222    ABLF02031920    ABLF02066369    JARK01000714    EYC35207.1    GBXI01006514    JAD07778.1    JOJR01000352    RCN39175.1    KN726977    KIH66756.1    KN730120    KIH61447.1    KE125416    EPB68564.1    KN727000    KIH66715.1    GEDC01018617    JAS18681.1    KN768221    KIH46987.1    GDHF01023009    GDHF01013882    GDHF01011651    JAI29305.1    JAI38432.1    JAI40663.1    KN726652    KIH67553.1    GECU01029708    JAS77998.1    KN747262    KIH51216.1    RCN39181.1    ABLF02032759    ABLF02032772    ABLF02058740    JOJR01000205    RCN42227.1    JOJR01000539    RCN36628.1    KQ422072    KOF75554.1    KN743176    KIH52626.1    GGMS01003728    MBY72931.1    ABLF02056721    KN739098    KIH54434.1    UYRW01004572    VDM92857.1    GDHF01032075    GDHF01018138    GDHF01015005    JAI20239.1    JAI34176.1    JAI37309.1    KN767628    KIH47495.1    ABLF02034212    ABLF02034217    GECZ01022632    JAS47137.1    KQ425820    KOF68955.1    KQ419117    KOF84553.1    JOJR01000395    RCN38503.1    KQ419623    KOF82821.1    KE125664    EPB67478.1    GFWV01003607    MAA28337.1    KQ419728    KOF82515.1    KQ416239    KOF97957.1    KQ416032    KOF99067.1    KQ418653    KOF86397.1    KN746970    KIH51320.1    KN769647    KIH46287.1    KQ420779    KOF79365.1    GFWV01012558    MAA37287.1   
Pfam
PF05970   PIF1        + More
PF14214   Helitron_like_N
PF02689   Herpes_Helicase
PF17919   RT_RNaseH_2
Interpro
IPR027417   P-loop_NTPase        + More
IPR010285   DNA_helicase_pif1-like       
IPR025476   Helitron_helicase-like       
IPR003840   DNA_helicase       
IPR041577   RT_RNaseH_2       
SUPFAM
SSF52540   SSF52540       

Ontologies

Topology

Length:
147
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00075
Exp number, first 60 AAs:
0.0002
Total prob of N-in:
0.05875
outside
1  -  147
 
 

Population Genetic Test Statistics

Pi
200.932163
Theta
124.976886
Tajima's D
1.911606
CLR
0
CSRT
0.869656517174141
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号