SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO13806
Pre Gene Modal
BGIBMGA009030
Annotation
PREDICTED:_uncharacterized_protein_LOC105842396_[Bombyx_mori]
Location in the cell
Cytoplasmic   Reliability : 1.246 Mitochondrial   Reliability : 1.024 Nuclear   Reliability : 1.053
 

Sequence

CDS
ATGCGCATCGTTAAATCGTCCAGTTTAAGTGCTGGAAATATCGCTGAGTTTAAGGAGCTCCTCCAGTCCTGTCATGAACGTATCGACGCGGTGGAAGCTCGAGTGCTTGGTCTTGAGGCTCGTCTAGCGGAGATCGTCTCAACAGTAGCAGCTTCTGACTTGGATTCCACTGAACTTCGCATGCAGCTGCGTGAACGCGACCAGGACTTGCTCAGGAATGATATTGACATCATTGGCTTGCCAATGATACCTCCCTAG
Protein
MRIVKSSSLSAGNIAEFKELLQSCHERIDAVEARVLGLEARLAEIVSTVAASDLDSTELRMQLRERDQDLLRNDIDIIGLPMIPP

Summary

Pfam
PF03258   Baculo_FP
Interpro
IPR019787   Znf_PHD-finger        + More
IPR013083   Znf_RING/FYVE/PHD       
IPR001965   Znf_PHD       
IPR011011   Znf_FYVE_PHD       
IPR004244   Transposase_22       
IPR019786   Zinc_finger_PHD-type_CS       
IPR004941   Baculo_FP       
SUPFAM
SSF57903   SSF57903       
Gene 3D

Ontologies

Topology

Length:
85
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00055
Exp number, first 60 AAs:
0.0004
Total prob of N-in:
0.27356
outside
1  -  85
 
 

Population Genetic Test Statistics

Pi
127.138002
Theta
153.278768
Tajima's D
-0.525689
CLR
1.359894
CSRT
0.231338433078346
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号