SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO13449  Validated by peptides from experiments
Pre Gene Modal
BGIBMGA010889
Annotation
reverse_transcriptase_[Bombyx_mori]
Location in the cell
Nuclear   Reliability : 3.467
 

Sequence

CDS
ATGTCGTTCAGTTGGATCGTAGTGTTAGCGTTCGTCAACATCATCGTCCTCTGTACAGCTACTTGTCCAGAAAACGAAGAACGCACCTGCCTTCAAGGTTTATGCAGACCTCAGAAGTGCATCGAAAAAAATGATATCATCTTCTGCCAATTAGTTGATGAGGAGAAGTGCGAATATGGATGTGCCTGCAAAATAGGATATCTGAGAGACGAAAATGGAACTTGTATACCGCAAGACAAGTGTCCAACTGTGCCTTGTCCAGTGAATGAATACTTCACGAACTGCGCTAAGGGCATGTGTCGTCAGGAGAACTGCACAGAGCTGGGCAAGTTGTCTGAATGTAAAACGCAATCGACAGAGCTGTGCGAGCCGGGCTGCGTTTGTGAAGGGGGCTTCTTGAGATCAAAAAACGGAACGTGCGTATCTATCGATGAATGCCATAGGGAACTATGTCCCGTGAACGAAGTGTACTCGAGCTGTCGACAGCCCAATTGTAATTCTGATAAATGCGAGTACAAATACAGGTCACAGTCGTGTCCCTCGGACGAACCCTGCGAAGTCGGTTGTGTTTGTAAAAGAGGATTTCGTAGGGCTGACAATGGCACCTGTGTCGATGAAAGAGATTGTGAATCCCAGCTTTGTTCAGTAAATGAACAGTATTTAAGTTGCATCCAAGCTGTTTGTCGGGTCGAGAAGTGTTCAGACCTGGGGGGATCCCTCAGTTGCAAGGGGGTGTCGGAAAGGGAATGCGTCGGTGGCTGCGTCTGTAAGGACAACTACTTCCGAGCTAAAAACGACACTTGTATTAAACTCAGTGATTGTGACGCTGACCTTTGCTCTGAAAATGAAATACACGTGAACTGTGTCCTAGCACAGTGTGGCCCAATGACGTGCTCAGAGAAGGACGCGGTAAATGTGTCGCCCGAGAAAATTGCCCAAATTAGGAATGTTCAGGCGAAAATGAAGAGTTTACCAACTGCACGAACCCATGTCCGCCGCGTACTTGCAATTCACTCGTCGCTCGTTTTGATTGTAACCCCCGCTCGCGATTCTGCCTGCTGTAGCACTATACAGCCCGAGCGGGTTCCTTTCCTTTTCCCCGCCGATTGCCGTTTTCACGGCATAGGCATTCCCCCCCCTGCTCCTTGCTGTCCTGCAGCACAGGGGGGTTACAAATCCTATCCGGGGCCTCGCCTTTCGGCGAGTTCAACAAAAGTCCCGGGGCCGCCCCCCCGGGCAAGAAGACCGAAGATGAGCGAAGATTTTGTGTGTGACAGTGAAAGTGCTAGGGACATTGTCGGGTTCCTCCGGGATAGGTACCCGTCAATTAGGGCCGAGTATCTCAGCTATAGGGCCGCTCGTGGCAATCCCTCCCCCCCCGCGTCCGTCGCCGCGTTTCTCAACCGTGCCTCGGAGGCACGCCGCGCGCCCCCCGCCGCCGCGTCAAGTTCGAGCGCACGTTCCCACGATGCGGCTCACATAGCGCCTAACGCTACCCCCACCCCCGCGCCCGCGTCGTTTACGTCATCGCGCGCTTCGTCCGTCGCGACCTCGATCGTTTCGAGTTCAGGCTCCGATACCGAATCGGAGATGGATTTCGAATCCGCGTCAAGCCCTCAGCCTGGAACTTCGGATGGGTTCCAAACCGTAACGCGCGGCAAAAAGCGTACTCGCGCCGTGGAGTCCCGGAGCTCCACGACGAAACAGACTAAATCCGCGACCGCCTCTCGACCAAAAGTAGTAGTTACACCGGAGTCGGACTCCGCGCGCCGCGTAACCCCACCGCCGCGTCCCAAGCCCGCGCCCGCTCCCCAAGTAGCTGCCCCGCCCCCGCTGATACTTCAAGAGAAGACAGCGTGGAATCGCGTGTCCCAGGCCCTTCAGGCAAATAAAATTAACTACACCCATGCGCGTAACGTCGCGCATGGGATTCAGATCAAGGTCGCAACGCCGGGCGACCATAGGGCCCTCTCAGCATACCTCCGAAAGGAGAACATAGGTTTCCACACCTATGCTCTTCAGGAGGACCGCGAGCTCCGCGTAGTAATACGCGGAGTCCCTAAGGAGCTAGAAATAGACTACATTAAGGAGGATCTGACCGCTCAGGCCCTCCCGATAGTTAGTGTGCACCGGATGCACAGCGGGCGGGGCAAACAGCCCTATAATATGATACTCGTGGCGTTAGAACCCACCCCGGAGGCCAAAAAGAAGATCGCATGTCTCACGACAATTTGCGGCCTATCCGGGATCTCGATCGAAGCCCCCCATAAGCGTGGCACTCCCGGACAGTGCTACAGGTGCCAACTCTATGGCCACTCAGCGCGTAATTGCCACGCGCGCCCCCGCTGCGTGAAATGCCTCGGCGATCACGCTACGTTAGATTGCGTTAGAGATAGGGAAACCGCGACCGAACCTCCCAGCTGTGTCCTATGCCTTAAGCAAGGGCACCCCGCGAACTACCGTGGATGTCCCAGGGCTCCGCGGAAACGTCCAACCCACCCAGCTCCGCGAACCGTCGGCCCAAAGACTTCGGCACCTTCAGTGCCGAAACCCGCCTTCGTGCCGGCTGCAGTTCCCACGGTCTCGGCGTGGAAAAAGCCGCTGCCGTATACGAAGGCGGGAACGGAAACCGCACCCCCGCCCCCGCTCGCGACACGCCCCGCGCCTCAGCCCCTGCTCGCACCTCGCCCCGCGCCCGCGTTCCGTCCCCCGCAACCCTCTGCCGCCAACGACTTCGCGCTCGTGCGCGACTTCGTCACCGCGGTGAACTTCGACCGTCTGCGATCGTTCGCTGACGCTATCCGTAGGTCGACAACCCCCGAACAGCGGCTCGCGGCCGCGTTCGATCACATGGACGTTTACGAGTCCGTGTCGCCATTCTATAATGCTAACGGACTCGCGCGGCAACGCGATCAAATTTTCGAATTCCTCCGCGATAATCTTGTAGATATTCTATTAGTGCAGGAAACCTGTCTGAAGCCCTCGCGTCGCGACCCGAAAGTAGCGAATTACGTCATGGTTAGGAATGACAGACTCACCGCCTCCAAAGGCGGGACTGCCATTTACTATAGGCGGGCCCTGCACGTTGTCCCTCTCGATACTCCCTCGCTCTCACATATCGAGGCGTCAGTGTGCCGTATCTCGCTGACGGGACACCAGCCGATCGTCATCGCATCCGTTTATCTCCCCCCGGACAAGCCCCTTCTGAGCAGTGACATCGAGTCACTGTTCGGCATGGGAGACTCCGTCATCCTGGCAGGCGATTTAAATTGCCACCACACTAGGTGGAACTGCCATCGTACTAACGTTAACGGTAGGCGTCTCGACGCGTTTATAGACGACCTCACCTTTGAAATAGTCGGTCCCCCAACTCCAACATGTTATCCGTATAACATCGCGCTCCGTCCGAGCACTATAGACCTGGCATTGCTTAGGAACGTAACTCTGCGCTTGCGTTCCATCGAAGCAATGTCAGAGCTCGACTCAGACCACCGACCTGTCGTTATGCAGCTCGGTCGCCCCCACAACCCAGTCACTGTTACGAGGACCATGGTGGATTGGAATAAGCTGGGCACATCTTCTAAAGAAGTCGATGTGGAGGACAGCTTCCACCGCATCAGACTGTCCCCCGATCTTAGGAATCTCTTAAGAGTTAGGAACGCGGCAATCCGGGCCTACGATCGTCTTCCCACGCATCCAAACCGGATTCGGATGCGTCGTCTACAACGCGAAGTCCACTCCCGCTTAAGCGACGCGCGTAACGATAATTGGCATAGTTATTTAGAACAACTCGCGCCCTCCCACCAAGCATACTGGCGACTAGCTAGGACTCTCAAATCCGAAACTACCGCTACTATGCCTCCCCTCGTACGCCCTTCAGGCCAACCACCGGCATTCGATGACGATGACAAGGCTGAGCTGCTGGCCGATGCACTGCAAGAGCAGTGCACCACCAGCACTCAACACGCGGACCCCGAACACACCGAGTTAGTCGACAGGGAGGTCGAGCGCAGAGCTTCCCTGCCGCCCTCGGACGCGTTACCCCCCATTACCACTGACGAAGTTAGAGACGCGATCCACAACCTACAACCTAGGAAGGCACCCGGCTCCGACGGCATCCACAACCGTGCGCTTAAACTCTTGCCAGTCCAACTGATAGCAATGTTGGCTACAATTTTAAATGCCGCTATGACGCACTGCATCTTTCCCGCGGTGTGGAAAGAAGCGGACGTTATCGGTATACATAAGCCGGGCAAACCGACAAACGAAACTTCTAGTTACCGTCCGATTAGTCTCCTCTCGACGATAGGAAAAATTTACGAACGGCTCCTTAGGAAACGCCTCTGGGATTTTGTTACCGCGAACAAAATTCTCATAGACGAACAGTTCGGATTCCGCTCAAAACACTCGTGCGTACAACAAGTGCACCGCCTCACGGAGCACATTCTGATAGGACTAAATAGGCGTAAACAAATCCCGACCGGCGCCCTCTTCTTCGACATCGCGAAGGCGTTCGACAAAGTCTGGCACAACGGTTTAATTTATAAACTATACAACATGGGAGTGCCAGACAGACTCGTGCTCATCATACGAGACTTCTTGTCGAACCGTTCGTTTCGATATCGAGTAGAGGGAACTCGTTCTCGTCCCCGCCAACTGACCGCCGGAGTCCCGCAAGGCTCCGCGCTCTCCCCGTTATTATTTAGTTTGTATATCAATGATATACCCCGGTCTCCGGAGACCCATCTAGCGCTCTTCGCCGATGACACGGCTATCTACTACTCGTGTAGGAAGATGTCGCTGCTTCATCGGCGACTCCAGATCGCAGTAGCCACCCTGGGACAGTGGTTCCGGAAGTGGCGAATAGACATCAACCCCACGAAAAGCGCAGCGGTGCTCTTCAAAAGGGGTCGCCCTCCGAACATCACTTCGAGCATCCCACTCCGTAGTAGGCGCGCAAACACCTCCGCCGTTAGTCCCATCACTCTCTTTGGCCAGCCCATTCCGTGGGTCTCGAAGGTCAAATATCTAGGCGTCACCCTCGACAGAGGGATGACATTCCGTCCCCATATAAAAACGGTACGCGACCGCGCCGCGTTTATTCTAGGACGACTCTATCCAATGCTTTGTAGTCGAAGCAAACTGTCCCTCCGCAATAAGGTAACTCTCTACAAAACTTGTATACGCCCCGTCATGACGTATGCAAGCGTAGTGTTCGCTCACGCAGCCCGCACCAACTTGAAATCCCTTCAGGTTATTCAATCACGATTCTGCAGGATAGCCGTCGGAGCGCCTTGGTTCCTTAGGAATGTGGATCTCCACGACGACCTGGAGCTCGACTCTTTTAGTAAGTATCTACAGTCGGCATCGCTGCGCCATTTTGAGAAGGCGGCACGACATGAGAACCCTCTCATCGTAGCCGCTGGAAATTACATACCCGACCCAGTAGACCGAATGGTAAACCGTCGACGTCGCCCAAAGCACGTCATTACGGATCCTCCTGATCCATTAACGGTGCTTTTAGGCACCACAAGCACCGGTCACCGTCCTCGTCGAACCCGTCGCTTGCGACGAAGGGCTCGACGAGCGAACTAA
Protein
MSFSWIVVLAFVNIIVLCTATCPENEERTCLQGLCRPQKCIEKNDIIFCQLVDEEKCEYGCACKIGYLRDENGTCIPQDKCPTVPCPVNEYFTNCAKGMCRQENCTELGKLSECKTQSTELCEPGCVCEGGFLRSKNGTCVSIDECHRELCPVNEVYSSCRQPNCNSDKCEYKYRSQSCPSDEPCEVGCVCKRGFRRADNGTCVDERDCESQLCSVNEQYLSCIQAVCRVEKCSDLGGSLSCKGVSERECVGGCVCKDNYFRAKNDTCIKLSDCDADLCSENEIHVNCVLAQCGPMTCSEKDAVNVSPEKIAQIRNVQAKMKSLPTARTHVRRVLAIHSSLVLIVTPARDSACCSTIQPERVPFLFPADCRFHGIGIPPPAPCCPAAQGGYKSYPGPRLSASSTKVPGPPPRARRPKMSEDFVCDSESARDIVGFLRDRYPSIRAEYLSYRAARGNPSPPASVAAFLNRASEARRAPPAAASSSSARSHDAAHIAPNATPTPAPASFTSSRASSVATSIVSSSGSDTESEMDFESASSPQPGTSDGFQTVTRGKKRTRAVESRSSTTKQTKSATASRPKVVVTPESDSARRVTPPPRPKPAPAPQVAAPPPLILQEKTAWNRVSQALQANKINYTHARNVAHGIQIKVATPGDHRALSAYLRKENIGFHTYALQEDRELRVVIRGVPKELEIDYIKEDLTAQALPIVSVHRMHSGRGKQPYNMILVALEPTPEAKKKIACLTTICGLSGISIEAPHKRGTPGQCYRCQLYGHSARNCHARPRCVKCLGDHATLDCVRDRETATEPPSCVLCLKQGHPANYRGCPRAPRKRPTHPAPRTVGPKTSAPSVPKPAFVPAAVPTVSAWKKPLPYTKAGTETAPPPPLATRPAPQPLLAPRPAPAFRPPQPSAANDFALVRDFVTAVNFDRLRSFADAIRRSTTPEQRLAAAFDHMDVYESVSPFYNANGLARQRDQIFEFLRDNLVDILLVQETCLKPSRRDPKVANYVMVRNDRLTASKGGTAIYYRRALHVVPLDTPSLSHIEASVCRISLTGHQPIVIASVYLPPDKPLLSSDIESLFGMGDSVILAGDLNCHHTRWNCHRTNVNGRRLDAFIDDLTFEIVGPPTPTCYPYNIALRPSTIDLALLRNVTLRLRSIEAMSELDSDHRPVVMQLGRPHNPVTVTRTMVDWNKLGTSSKEVDVEDSFHRIRLSPDLRNLLRVRNAAIRAYDRLPTHPNRIRMRRLQREVHSRLSDARNDNWHSYLEQLAPSHQAYWRLARTLKSETTATMPPLVRPSGQPPAFDDDDKAELLADALQEQCTTSTQHADPEHTELVDREVERRASLPPSDALPPITTDEVRDAIHNLQPRKAPGSDGIHNRALKLLPVQLIAMLATILNAAMTHCIFPAVWKEADVIGIHKPGKPTNETSSYRPISLLSTIGKIYERLLRKRLWDFVTANKILIDEQFGFRSKHSCVQQVHRLTEHILIGLNRRKQIPTGALFFDIAKAFDKVWHNGLIYKLYNMGVPDRLVLIIRDFLSNRSFRYRVEGTRSRPRQLTAGVPQGSALSPLLFSLYINDIPRSPETHLALFADDTAIYYSCRKMSLLHRRLQIAVATLGQWFRKWRIDINPTKSAAVLFKRGRPPNITSSIPLRSRRANTSAVSPITLFGQPIPWVSKVKYLGVTLDRGMTFRPHIKTVRDRAAFILGRLYPMLCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVGAPWFLRNVDLHDDLELDSFSKYLQSASLRHFEKAARHENPLIVAAGNYIPDPVDRMVNRRRRPKHVITDPPDPLTVLLGTTSTGHRPRRTRRLRRRARRAN

Summary

Uniprot
ProteinModelPortal
PDB
6AR3     E-value=6.1325e-05,     Score=117

Ontologies

Topology

SignalP
Position:   1 - 20,         Likelihood:  0.998351
 
 
Length:
1864
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
5.37710999999997
Exp number, first 60 AAs:
4.93359
Total prob of N-in:
0.24742
outside
1  -  1864
 
 

Population Genetic Test Statistics

Pi
16.043634
Theta
14.67516
Tajima's D
0
CLR
1.703747
CSRT
0.380530973451327
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Peptides ×
Source Sequence Identity Evalue
27102218 ECVGGCVCKDNYFR 96.97 2e-17
27102218 NDIIFCQIVDEEK 100.00 7e-14
26822097 SQSCPSDEPCEVGCVCKR 96.00 5e-12
25860555 DCSSKPICGENEESSDCANRYDSPDCYVDPK 96.00 5e-12
24402669 CIEIDEIEMEERCDDFNENAEHYI 96.00 5e-12
27102218 TQSTEICEPGCVCEGGFIR 96.00 5e-12
26822097 CPTVPCPVNEYFTNCAK 95.24 5e-09
25860555 SVIDAAYDAIDKNR 95.24 5e-09
26280517 MQAFAGIPQTGVIDEPTK 95.24 5e-09
24093152 NDIIFCQIVDEEK 95.24 5e-09
24402669 NDIIFCQIVDEEK 95.24 5e-09
27102218 TCIQGICRPQK 95.24 5e-09
28467696 NDIENQQPIIDVIR 95.24 5e-09
29197581 ISDCDADICSENEIHVNCVIAQCGPMTCSEK 95.24 5e-09
26822097 DCESQICSVNEQYISCIQAVCR 100.00 1e-05
25860555 ERNVHYVSDGEAVAASSDAR 100.00 1e-05
24093152 SQSCPSDEPCEVGCVCK 100.00 1e-05
24402669 SQSCPSDEPCEVGCVCK 100.00 1e-05
27102218 DGPMYCPSVDQK 100.00 1e-05
26822097 DGPMYCPSVDQK 100.00 1e-05
25860555 FIYFHSIASTTENVVK 100.00 1e-05
26280517 CFIDQGPCTAEGTEFK 100.00 1e-05
25044914 CPPSIVIIDIK 100.00 1e-05
24093152 CPQPTTPAPPR 100.00 1e-05
24402669 CPPGEVYQACAYK 100.00 1e-05
27102218 QPNCNSDKCEYK 100.00 1e-05
28467696 CPSDQWECPQASGR 100.00 1e-05
29197581 CSDIGGSISCK 100.00 1e-05
26822097 TCIQGICRPQK 100.00 7e-05
25860555 AIVVTDGER 100.00 7e-05
26280517 SITVDQIK 100.00 7e-05
24093152 SQQAHSSSSK 100.00 7e-05
24402669 SQPFTINVEGVIR 100.00 7e-05
27102218 CPTVPCPVNEYFTNCAK 100.00 7e-05
28467696 SQQPQITHIEEVGSAVISR 100.00 7e-05
29197581 NDIIFCQIVDEEKCEYGCACK 100.00 7e-05
24402669 ECVGGCVCK 100.00 2e-04
27102218 ISDCDADICSENEIHVNCVIAQCGPMTCSEKDGPMYCPSVDQK 100.00 2e-04
24402669 GVSEAWGYKPFK 100.00 0.002
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号