SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO13414
Annotation
PREDICTED:_antigen_43-like_isoform_X5_[Salmo_salar]
Location in the cell
Extracellular   Reliability : 1.885 Nuclear   Reliability : 1.638
 

Sequence

CDS
ATGCTGCAAAGTCGCTCTGCAACGTCATGCTGCAACGTCATTCTGCAACGTCGCTCTGCAACGTCATGCTGCAACGTCGCTATGCAACGTCATTCTGCAACGTCGCTCTGCAACGTCATGCTGCAACGTCGCTCTGCAACGTCATTCTGCAACGTCGCTCTGCAACGTCGCTATGCAACGTCATGCTGCAAAGTCGCTCTGCAACGTCATTCTGCAACGTCGCTCTGCAACGTCATTCTGCAACGTCGCTCTGCAACGTCGCTATGCAACGTCATGCTGCAAAGTCGCTCTGCAACGTCATGCTGCAACGTCATTCTGCAACGTCGCTATGCAACGTCATTCTGCAACGTCGCTCTGCAACGTCGCTATGCAACGTCATTCTGCAACGTCGCTCTGCAACGTCATTCTGCAACGTCGCTCTGCAACGTCATTCTGCAATGTCATTCTGCAACGTCGCTCTGCAACGTCGCTATGCAACGTCATGCTGCAAAGTCGCTCTGCAACGTCGCTATGCAACGTCATGCTGCAAAGTCGCTCTGCAACGTCATTCTGCAACGTCGCTCTGCAACGTCATGCTGCAACGTCGCTCTGCAACGTCATTCTGCAACGTCGCTCTGCAACGTCGCTATGCAACGTCATGCTGCAAAGTCGCTCTGCAACGTCATTCTGCAACGTCGCTCTGCAACGTCATTCTGCAACGTCGCTCTGCAACGTCGCTATGCAACGTCATGCTGCAAAGTCGCTCTGCAACGTCATTCTGCAACGTCGCTCTGCAACGTCATGCTGCAACGTCATTCTGCAACGTCGCTCTGCAACGTCATGCTGCAACGTCGCTCTGCAACGTCGCTCTGCAACGTCATGCTGCAACGTCATTCTGCAACGTCATGCTGCAACGTCGCTCTGCAACGTCATTCTGCAACGTCATTCTGCAACGTCGCTCTGCAACGTCATGCTGCAACGTCATTCTGCAACGTCATTCTGCAACGTCATGCTGCAACGTCGCTATGCAACGTCATTCTGCAACGTCGCTCTGCAACGTCATGCTGCAACGTCGCTCTGCAACGTCATGCTGCAACGTCGCTCTGCAACGTCATGCTGCAACGTCGCTCTGCAACGTCATGCTGCAACGTCGCTCTGCAACGTCATGCTGCAACGTCGCTCTGCAACGTCGCTATGCAACGTCATGCTGCAAAGTCGCTCTGCAACGTCATTCTGCAACGTCATGCTGCAACGTCGCTATGCAACGTCATTCTGCAACGTCATGCTGCAACGTCGCTCTGCAACGTCATGCTGCAACGTCGCTCTGCAACGTCATGCTGCAACGTCGCTCTGCAACGTCATGCTGCATCGTCGCTCTGCAACGTCATGCTGCAACGTCGCTCTGCAACGTCATTCTGCAACGTCGCTCTGCAACGTCGCTATGCAACGTCATGCTGCAAAGTCGCTCTGCAACGTCATTCTGCAACGTCATGCTGCAACGTCGCTATGCAACGTCGCTCTGCAACGTCGCTATGCAACGTCATGCTGCAAAGTCGCTCTGCAACGTCGCTATGCAACGTCATGCTGCAACGTCATTCTGCAAAGTCGCTATGCAACGTCATTCTGCAACGTCGCTCTGCAACGTCATGCTGCAACGTCATTCTGCAACGTCGCTCTGCAACGTCATGCTGCAACGTCGCTCTGCAACGTCATGCTTCAACGTCCCTCAGCAACGTCATGCTGCAAAGTCGCTCTGCAACGTCATTCTGCAACGTCGCTCTGCAACGTCATGCTGCAACGTCGCTCTGCAACGTCGCTCTGCAACGTCATGCTGCAACGTCATTCTGCAACGTCATGCTGCAACGTCGCTATGCAACGTCATTCTGCAACGTCGCTCTGCAACGTCATGATGCAACGTCGCTCTGCAACGTCATGCTGCAACGTCGCTCTTCAACGTCATGCTGCAACGTCATTCTGCAACGTCACGCTGCAACGTCGCTATGCAACGTCATTCTGCAACGTCGCTCTGCAACGTCATGCTGCAACGTCATTCTGCAACGTCGCTCTGCAACGTCATGCTGCAACGTCGCTCTGCAACGTCATGCTTCAACGTCCCTCAGCAACGTCATGCTGCAAAGTGTCTAA
Protein
MLQSRSATSCCNVILQRRSATSCCNVAMQRHSATSLCNVMLQRRSATSFCNVALQRRYATSCCKVALQRHSATSLCNVILQRRSATSLCNVMLQSRSATSCCNVILQRRYATSFCNVALQRRYATSFCNVALQRHSATSLCNVILQCHSATSLCNVAMQRHAAKSLCNVAMQRHAAKSLCNVILQRRSATSCCNVALQRHSATSLCNVAMQRHAAKSLCNVILQRRSATSFCNVALQRRYATSCCKVALQRHSATSLCNVMLQRHSATSLCNVMLQRRSATSLCNVMLQRHSATSCCNVALQRHSATSFCNVALQRHAATSFCNVILQRHAATSLCNVILQRRSATSCCNVALQRHAATSLCNVMLQRRSATSCCNVALQRHAATSLCNVAMQRHAAKSLCNVILQRHAATSLCNVILQRHAATSLCNVMLQRRSATSCCNVALQRHAASSLCNVMLQRRSATSFCNVALQRRYATSCCKVALQRHSATSCCNVAMQRRSATSLCNVMLQSRSATSLCNVMLQRHSAKSLCNVILQRRSATSCCNVILQRRSATSCCNVALQRHASTSLSNVMLQSRSATSFCNVALQRHAATSLCNVALQRHAATSFCNVMLQRRYATSFCNVALQRHDATSLCNVMLQRRSSTSCCNVILQRHAATSLCNVILQRRSATSCCNVILQRRSATSCCNVALQRHASTSLSNVMLQSV

Summary

Pfam
PF13306   LRR_5        + More
PF07645   EGF_CA
Interpro
IPR011004   Trimer_LpxA-like_sf        + More
IPR026906   LRR_5       
IPR033201   HRNR       
IPR037727   KIAA0754       
IPR001762   Disintegrin_dom       
IPR036436   Disintegrin_dom_sf       
IPR009030   Growth_fac_rcpt_cys_sf       
IPR001881   EGF-like_Ca-bd_dom       
IPR000742   EGF-like_dom       
IPR018097   EGF_Ca-bd_CS       
SUPFAM
SSF51161   SSF51161        + More
SSF57552   SSF57552       
SSF57184   SSF57184       
Gene 3D

Ontologies

Topology

Length:
707
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00241
Exp number, first 60 AAs:
0.00023
Total prob of N-in:
0.00042
outside
1  -  707
 
 

Population Genetic Test Statistics

Pi
0
Theta
0
Tajima's D
0
CLR
377.539373
CSRT
0
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号