SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO13367
Annotation
endonuclease-reverse_transcriptase_[Bombyx_mori]
Location in the cell
Nuclear   Reliability : 2.43
 

Sequence

CDS
ATGTGGGAAAGCCTAGAAAAGCAAGGTATACCAGAAACATATTTAGACATTATCAAAAATATATATGCAAACAGTAAAGCAAAAATCCAGTTAGAAACCCTGGGAAAAGAATTCGGAATCAAGCGAGGAGTCAGGCAGGGAGACCCAATGTCCCCAAAGTTGTTTTCAGCAGTGCTAGAGAACGTCTTTCGCAACCTTGACTGGGAACATCTAGGCCTCAACATAGACGGACGGAAACTAAACCACTTAAGATTCGCGGACGATATAGTTCTGCTTGAAGAAAATCCAAAGGCACTCGAAAAGATGATCCAAGCTCTAAATACTGAAAGCTCCAAAGTGGGGTTAAAAATGAACATAACAAAAACGAAATTGATGACTAACTCAGAAATAAGGCCCATTGAAATTGATGGACAAAAAGTAGAATATGTTGACGAATATTGCTACTTGGGTCAGATCATCTCCCCTAAAGACCAAACAACCAAGGAAATAAATAAGAGGATTGCTAATGGGTGGAAAAAATACTGGTCTCTTAAGGAAGTTGTAAAAGCTAAAGAACACAATATGGCAACGAAGAGGAAAGTATTCAATACTTGTATTCTCCCATGCATCACATACGGCTGCGAAACATGGTCCCTTACAAAACACCATAGAGAAAAACTGGGAAAGTGCCAGAGAGGTATGGAACGAAGCATGACAGGAACAAGAAGACAAGATAGAGTTAGCAATGTGCAATTAAGAGAAAAAACAAAACTAACTGACATCCTGGAAAAAATAGACCTCCAAAAATGGAGATGGACCGGCCATATGTTGAGATCTAGACAAGAAAAGTGGAGTCAAATTATAACGAACTGGTATCCAAGAGATGGCAAGAGGTGTCGAGGACGTCAACAAATGCGATGGGAAAATGAGCTGAAACTTACCGCCGGACCCAAATGGAGAAGAGTTGCTCAAGATAGAAAACAATGGAGACTACTGGAGGAGGCCTTTGCCAGAAGGCACACTGAGTTGAGAGACATCTTATAA
Protein
MWESLEKQGIPETYLDIIKNIYANSKAKIQLETLGKEFGIKRGVRQGDPMSPKLFSAVLENVFRNLDWEHLGLNIDGRKLNHLRFADDIVLLEENPKALEKMIQALNTESSKVGLKMNITKTKLMTNSEIRPIEIDGQKVEYVDEYCYLGQIISPKDQTTKEINKRIANGWKKYWSLKEVVKAKEHNMATKRKVFNTCILPCITYGCETWSLTKHHREKLGKCQRGMERSMTGTRRQDRVSNVQLREKTKLTDILEKIDLQKWRWTGHMLRSRQEKWSQIITNWYPRDGKRCRGRQQMRWENELKLTAGPKWRRVAQDRKQWRLLEEAFARRHTELRDIL

Summary

EMBL
KZ150485    PZC70710.1    FJ265564    ADI61832.1    ODYU01004982    SOQ45402.1    + More
FJ265561    ADI61829.1    KZ149912    PZC78089.1    KZ150108    PZC73382.1    KZ150317    PZC71439.1    FJ265563    ADI61831.1    GFTR01005437    JAW10989.1    FJ265562    ADI61830.1    GBBI01004876    JAC13836.1    MRZV01000899    PIK42833.1    KZ149907    PZC78256.1    GBGD01000380    JAC88509.1    AAGJ04144474    MRZV01000640    PIK46507.1    ODYU01008249    SOQ51673.1    FJ265549    ADI61817.1    RSAL01002362    RVE40503.1    RSAL01000016    RVE53061.1    ODYU01004088    SOQ43598.1    FJ265542    ADI61810.1    FJ265551    ADI61819.1    UZAG01000503    VDO08661.1    KZ149985    PZC75698.1    EF113399    EF113400    ABO45233.1    EF113398    EF113401    ABO45231.1    MRZV01002136    PIK34564.1    GFAC01005640    JAT93548.1    EF113402    ABO45239.1    JARK01001396    EYC09581.1    FJ265544    ADI61812.1    FJ265550    ADI61818.1    FJ265543    ADI61811.1    JARK01000807    EYC34984.1    JARK01001434    EYC02684.1    FJ265545    ADI61813.1    KZ150072    PZC74016.1    JARK01001362    EYC18843.1    EYC18844.1    JARK01000347    EYC38051.1    JARK01001621    EYB86109.1    JARK01000460    EYC36749.1    JARK01001351    EYC23394.1    JARK01001340    EYC30828.1    JARK01001626    EYB85833.1    JARK01001370    EYC16151.1    JARK01001736    JARK01001462    JARK01001379    JARK01001338    EYB80775.1    EYB98943.1    EYC13646.1    EYC33347.1    JARK01001677    EYB83167.1    EYB83168.1    EYC23395.1    AAGJ04050748    EYC31295.1    JARK01001512    EYB94036.1    JARK01001655    EYB84321.1    JARK01000388    EYC37469.1    EYC16150.1    JARK01000173    EYC41342.1    JARK01001348    EYC25050.1    EYC25048.1    GBBI01004877    JAC13835.1    EYC25049.1    RSAL01002130    RVE40575.1    GDKW01001596    JAI54999.1    GBGD01000453    JAC88436.1    JARK01001414    JARK01001412    EYC06128.1    EYC06440.1    JARK01001372    EYC15539.1    JARK01001608    EYB86877.1    JARK01000449    EYC36872.1    JARK01000224    EYC40226.1    JARK01001367    EYC17351.1    CAVP010058300    CDL94394.1    JARK01001473    EYB97806.1    JARK01001343    EYC28635.1    JARK01000189    EYC40935.1    EYC25046.1    JARK01001639    EYB85201.1    JARK01001389    EYC11015.1    JARK01001615    EYB86390.1    UZAG01005986    VDO18177.1    JARK01001364    EYC18031.1    GL379822    EGT48339.1    DS268587    EFO92044.1    DS269943    EFO90109.1    JARK01001423    EYC04578.1    JARK01001438    EYC02012.1    DS268736    EFP00597.1    JARK01001344    EYC28218.1    JARK01001349    EYC24735.1    JARK01001361    EYC19034.1    JARK01001346    EYC26784.1    EYC25257.1    JARK01001341    EYC30223.1    JARK01001407    EYC07212.1    JARK01001612    EYB86585.1    JARK01001636    EYB85342.1    EYB85344.1    JARK01001342    EYC29360.1   
Pfam
PF00078   RVT_1        + More
PF14529   Exo_endo_phos_2
PF13855   LRR_8
PF01826   TIL
Interpro
IPR000477   RT_dom        + More
IPR005135   Endo/exonuclease/phosphatase       
IPR036691   Endo/exonu/phosph_ase_sf       
IPR032675   LRR_dom_sf       
IPR001611   Leu-rich_rpt       
IPR003591   Leu-rich_rpt_typical-subtyp       
IPR029052   Metallo-depent_PP-like       
IPR036084   Ser_inhib-like_sf       
IPR002919   TIL_dom       
IPR017452   GPCR_Rhodpsn_7TM       
SUPFAM
SSF56219   SSF56219        + More
SSF57567   SSF57567       
Gene 3D
PDB
5HHL     E-value=0.0881237,     Score=83

Ontologies

Topology

Length:
340
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.03036
Exp number, first 60 AAs:
0
Total prob of N-in:
0.01245
outside
1  -  340
 
 

Population Genetic Test Statistics

Pi
5.195628
Theta
14.375825
Tajima's D
-0.838803
CLR
3.908824
CSRT
0.167591620418979
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号