SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO13262  Validated by peptides from experiments
Pre Gene Modal
BGIBMGA004726
Annotation
PREDICTED:_antichymotrypsin-2-like_[Bombyx_mori]
Location in the cell
Extracellular   Reliability : 3.55
 

Sequence

CDS
ATGATTCACTTTTTAGCGAGTTGCGGCGGAGATCGTAATGCGCGGCCCGGCTGCGGCGTCAACTGCAATAAGCGTTGTTCAGATATTGGACAGGAACCTCAATCTTGTATACAGATATGCTACAGCAACGCTTGCGACTGTAAAGATGGTTTTTATTTAGACACCAACACGGGGAAATGCGTTCTTCCCGAAAAATGCACTCCTACTTGTGGAAAAGATGAAGTCTACAATGATTGTATACAAGGGTACTGCCAACCGAAGAATTGTTCGGAAATAGGGAAACCCGTTGCTTGTCCAAGAATAGATCCCAAGAATTGCATCAAAGGGTGCTTGTGTAAAGAAAACTACGTCAGAGCTGATAATGGAACGTGTATACCAAAAACCGACTGTCCAAAACAACTTTGTGGCGAAAACGAAGAATCTTCAGATTGCGCCAATTGCTATGATAGTCCAGATTGTTGTGTGGATCCTATGGATTGCATTCAAGGATGCATTTGCAAAGTAGGATACGTGAGGAACGATGAAGGAGTTTGTGTTCGAGATGATTGTGATGACTCATGCAATGGGGATCCGAACGCTGTTGTTGGATGTGGAGTAAATTGTAACAGACATTGTTCTAATATCGGCAAAGAAAGTCAAAGTTGTGCTGCTGTTTGCTACGAAGACGGCTGCGATTGTAAAGACGGATATTATTACGATGACAACATTAATAAATGTGTTTTACCCGAAGACTGCACTCCTACTTGTGGAAAAGATGAAGTCTACAATGATTGTATACAAGGGTACTGCCAACCGAAGAATTGTTCGGAAATAGGGAAACCCGTTGCTTGCCCAAGAATAGATCCCAAGAATTGCATCAAAGGGTGCTTGTGTAAAGAAAACTACGTCAGAGCTGATAATGGAACGTGTATACCAAAAACCGACTGTCGACAATGTCGACCAAAGAGCTGCTCTCAGCTTGGAAAGCCGCTGTCTTGTCCTAGAATTGATCCTAAATACTGTAAAGGAGGCTGTCTCTGCGAAGACGGTTATGTAAAAGCTAAGAATGGTACTTGCATACCAGAGAAAGAATGTCCATCATGTGGCGGTGATCCGAATGCCGAAGCTGGTTGTGGGATAAATTGTAACAGGCGTTGTTCAGATGTTGGCAAGGACCCTGGAGTGTGCGAGGACGATATATGTGCTGTAAACGGTTGTGATTGTAAACAAGGATATTACTATGATTACGTCTCATCGAAATGTGTTCTACCAGATCGATGTCCTACTAGCAATTCACCAGGAAATGTCGACCAATCGTTGGAAAAACTCCGCACAGGAAACATGGCATTAGTTGGCCAGTTTCTTTGGGAATTATACAAAATGGATCCAGGACAAAGTTTCGTTACATCACCCGTATCTGTACTCATTCCTTACGGTCAACTAGCGCTATACGCCGTTAGAGAAACTTTAGATCAACTATTAAAGTTTATAAACCTCGACAATAAGGATCAGATCAAGGAACCTTTCCCCGCTTTGCTTACGAATTATCGGTCTCAAAGCTCAGTTCTTTTGACGGTGGCAGTTAAATGCTACGGCAACATAAATTATCCTTTTACGGACCAGTTTAAGAACGACGCTGTAACTTATTTTGACTCAGAAGGAGAAAATATTGATTTTAAATATGCGAAACAAGCAGCAGACACAATAAACGGATGGGTTGCAAACAAAACCAATAACTTAATTCAAAATCTTGTCAGCGAAGATTTGTTCAGCGATGACACTAGATTGGTTCTAGTTAACGCCATTTATTTCCTTGGAAATTGGCAAAATCAGTTCAATCCTAATAACACTCGCGACAGAGACTTCTACATCACACCAAATAAAACTAAGTCCATAAAGACTATGTATCAAGAAAACACCTTTAATTATGGAGAAAATGAGATTCTTGATGCACAGATCTTAGAATTGTTCTACAAAGGCGGCAATTCTAGTTTAGTAATCTTGTTACCAAAGAAAAAAGATGGCCTTCTTCAGATGTTAGATAAATTACGAAATTCAGATGAATTATCTAATAGTATTAAATCACTTAGGCGAGAGAAAGTCAAAGTATTCCTACCTAAGATGGATATAGAAACGAAAATCGATATAGCAGAACTTTCCCAGAAGCTGAATGTAACCAAAATGTTCGATCCACGATCAGATGATTTCGAAGGAATTTTATTAAATTCGGACCCTGTATATGTTTCTGCTGCAATACAGAAAGCTAAAATCATAGTTGATGAAACTGGAACCGAGGCAGCGGCAGCAACTGCTGTTGTCGGTGCTAGAGCGACATCCGCAATTATTCCGGAGAACGAATATTACTTCATAGCTGACAGAAGCTATGTTTTTTGTGTGTTACTCGAAAGGGATCCATTGTTTTGTGGTGTCTTTAATGGAAATTAA
Protein
MIHFLASCGGDRNARPGCGVNCNKRCSDIGQEPQSCIQICYSNACDCKDGFYLDTNTGKCVLPEKCTPTCGKDEVYNDCIQGYCQPKNCSEIGKPVACPRIDPKNCIKGCLCKENYVRADNGTCIPKTDCPKQLCGENEESSDCANCYDSPDCCVDPMDCIQGCICKVGYVRNDEGVCVRDDCDDSCNGDPNAVVGCGVNCNRHCSNIGKESQSCAAVCYEDGCDCKDGYYYDDNINKCVLPEDCTPTCGKDEVYNDCIQGYCQPKNCSEIGKPVACPRIDPKNCIKGCLCKENYVRADNGTCIPKTDCRQCRPKSCSQLGKPLSCPRIDPKYCKGGCLCEDGYVKAKNGTCIPEKECPSCGGDPNAEAGCGINCNRRCSDVGKDPGVCEDDICAVNGCDCKQGYYYDYVSSKCVLPDRCPTSNSPGNVDQSLEKLRTGNMALVGQFLWELYKMDPGQSFVTSPVSVLIPYGQLALYAVRETLDQLLKFINLDNKDQIKEPFPALLTNYRSQSSVLLTVAVKCYGNINYPFTDQFKNDAVTYFDSEGENIDFKYAKQAADTINGWVANKTNNLIQNLVSEDLFSDDTRLVLVNAIYFLGNWQNQFNPNNTRDRDFYITPNKTKSIKTMYQENTFNYGENEILDAQILELFYKGGNSSLVILLPKKKDGLLQMLDKLRNSDELSNSIKSLRREKVKVFLPKMDIETKIDIAELSQKLNVTKMFDPRSDDFEGILLNSDPVYVSAAIQKAKIIVDETGTEAAAATAVVGARATSAIIPENEYYFIADRSYVFCVLLERDPLFCGVFNGN

Summary

Similarity
Belongs to the serpin family.
Pfam
PF00079   Serpin        + More
PF01826   TIL
Interpro
IPR042185   Serpin_sf_2        + More
IPR002919   TIL_dom       
IPR036084   Ser_inhib-like_sf       
IPR023796   Serpin_dom       
IPR042178   Serpin_sf_1       
IPR036186   Serpin_sf       
IPR000215   Serpin_fam       
IPR023795   Serpin_CS       
IPR000742   EGF-like_dom       
SUPFAM
SSF56574   SSF56574        + More
SSF57567   SSF57567       
Gene 3D
PDB
1SEK     E-value=1.59654e-60,     Score=593

Ontologies

Topology

Length:
807
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.01371
Exp number, first 60 AAs:
0
Total prob of N-in:
0.00003
outside
1  -  807
 
 

Population Genetic Test Statistics

Pi
271.184425
Theta
178.623052
Tajima's D
2.019363
CLR
0.536754
CSRT
0.885255737213139
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Peptides ×
Source Sequence Identity Evalue
25860555 QPIQPVSQEDKNDIK 100.00 2e-15
27102218 CYGNINYPFTDQFK 100.00 2e-15
26822097 DGYYYDDNINK 100.00 6e-14
25860555 YGKECEEYQVVTEDGYIITIFR 100.00 6e-14
24093152 NDEGVCVR 100.00 6e-14
27102218 DGYYYDDNINK 100.00 6e-14
26822097 CVIPDR 96.43 6e-13
25860555 NSNEFVIFKEDSVPMTEIMK 96.43 6e-13
24093152 CVIPEDCTPTCGK 96.43 6e-13
27102218 SCSQIGKPISCPR 96.43 6e-13
26822097 CSDYEGGPK 96.67 2e-12
25860555 EFHYGPDPVQEAIASDVK 96.67 2e-12
27102218 NCSQIGYPVACPMIQASSCTQGCICK 96.67 2e-12
26822097 ESQSCAAVCYEDGCDCK 100.00 4e-10
26822097 ECPSCGGDPNAEAGCGINCNRR 100.00 3e-09
24093152 CSDIITDDITK 100.00 3e-09
27102218 SCSQIGK 100.00 3e-09
26822097 NCSEIGKPVACPR 100.00 4e-09
26822097 NCSEIGKPVACPR 100.00 4e-09
25860555 NIIAAGTNTNIDKNHK 100.00 4e-09
25860555 NIIAAGTNTNIDKNHK 100.00 4e-09
27102218 CVIPEDCTPTCGKDEVYNDCIQGYCQPK 100.00 4e-09
27102218 CVIPEDCTPTCGKDEVYNDCIQGYCQPK 100.00 4e-09
26822097 CSDIGKEPGACIIICYDNACDCK 100.00 1e-08
24093152 ECPSCGGDPNAEAGCGINCNR 100.00 1e-08
26822097 NDEGVCVR 100.00 1e-08
24093152 DCYDDSDEENCIYR 100.00 1e-08
26822097 DGFYIDTNTGK 100.00 6e-08
24093152 ECPIACPSTCEAPEAKPCKK 100.00 6e-08
26822097 RCSDVGKDPGVCEDDICAVNGCDCK 100.00 2e-05
24093152 DPGATTGGEIIIGGSDPAHYR 100.00 2e-05
26822097 CYGNINYPFTDQFK 100.00 4e-05
25860555 WPEYDPAK 100.00 4e-05
24093152 NCSEIGKPVACPR 100.00 4e-05
27102218 CYGNINYPFTDQFKNDAVTYFDSEGENIDFK 100.00 4e-05
26822097 EPGACIIICYDNACDCK 100.00 4e-04
26822097 EPGACIIICYDNACDCK 100.00 4e-04
25860555 NTFTIR 100.00 4e-04
25860555 NTFTIR 100.00 4e-04
24093152 DEVVVVGFFEK 100.00 4e-04
24093152 DEVVVVGFFEK 100.00 4e-04
26822097 MIQASSCTQGCICK 100.00 0.001
25860555 EHDHCTDIIPAGETK 100.00 0.001
24093152 CYCSCDINSKPVFISIDGSAIKPR 100.00 0.001
27102218 IKCNQNEVFDICPAPCPPR 100.00 0.001
26822097 DPIFCGVFNGN 100.00 0.002
25860555 GTNDFIGINYYTSCTVR 100.00 0.002
24093152 ATQGQPIPTEIDER 100.00 0.002
27102218 IRNSDEFFNSIK 100.00 0.002
26822097 CPTSNSPGNVDQSIEK 100.00 0.022
26822097 CPTSNSPGNVDQSIEK 100.00 0.022
25860555 AEFIECDITKDIER 100.00 0.022
25860555 AEFIECDITKDIER 100.00 0.022
24093152 NCIVDSVSYNDEEAEMK 100.00 0.022
24093152 NCIVDSVSYNDEEAEMK 100.00 0.022
27102218 AENGICIPGEK 100.00 0.022
27102218 AENGICIPGEK 100.00 0.022
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号