SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO13256  Validated by peptides from experiments
Pre Gene Modal
BGIBMGA004726
Annotation
PREDICTED:_antichymotrypsin-2-like_[Bombyx_mori]
Full name
Antitrypsin       + More
Antichymotrypsin-2      
Alaserpin      
Alternative Name
Antichymotrypsin II
Serpin-1
Location in the cell
Extracellular   Reliability : 1.794
 

Sequence

CDS
ATGTATCCCGAAGACAGAGTGCCAATTGATCCTAAATACTGTAAAGGAGGCTGTCTCTGTGAAGACGGCTATGTAAAAGCTAAGAATGGTACTTGCATACCAGAGAAAGAATGTCCATCATGTGGCGGTGATCCGAATGCCGAAGCTGGTTGTGGGATAAATTGTAACAGGCGTTGTTCAGATGTTGGCAAGGACCCTGGAGTGTGCGAGGACGATATATGTGCTGTAAACGGTTGTGATTGTAAACAAGGATATTACTATGATTACGTCTCATCGAAATGTGTTCTACCAGATCGATGTCCTACTACCAATTCATCGGGAAATGTCGACCAATCCTTGGAAAAACTCCGCAGAGGAAACATGGCATTAGTTGGCCAGTTTCTTTGGGAATTATACAAAATGAATCCAGGACAAAGTTTCGTTACATCACCCGTATCTGTACTCATTCCTTACGGTCAACTAGCGCTATACGCCGTTGGAGAAACTTTAGATCAACTATTAAAGTTTATAAACCTCGACAATAAGGATCAGATCAAGAAAGCTTTCCCCGCGTTGCTTAAGAATTATCGGTCTCAAACCTCAGTTCTTTTGACGGTGGCAGTTAAATGCTACGGCAACATAAATTATCCTTTTACGGACCAGTTTAAGAACGACGCTGTAACTTATTTTGACTCAGAAGGAGAAAATATTGATTTTAAATATGCGAAACAAGCTGCAGACACAATAAACGGATGGGTCGCAAACAAAACCAATAACTTAATTCAAAATCTTGTCAGCGAAGATTTGTTCAGCGATGACACTAGATTGGTTCTAGTTGACGCCATTTATTTGCATGGAATTTGGCAAAATCAGTTCAATCCTAATAACACTCACGACAGAGACTTCTACATCACACCAAACAAAACTAAGTCCATAAAGACTATGTATCAAGAAAACTTCTTTAATTATGGAGAAAACGAGATTCTTGATGCACAGATCTTAGAATTGTTCTACAAAGGCGGCAATTCTAGTTTAGTAATCTTGTTACCAAAGAAAAAAGATGGCCTACCCCAGATGTCACATAAATTACGAAATTCAGATGAATTTTTTAATAGCATTAAATCACTTAGGCGAGAGAAAGTCAAATGTTTCCTACCTAAGATGGATATAAAAACGAACATCGATATGGCAGACCTTTCCCAGAAGATGAACGTAACCAAAATGTTCGATCCACAATCAAATGATTTCGAAGGAATTTTATTAAATTCGGACCCCGTATATGTTTCTGCTGCAATACAGAAAGCTCAAATCATAGTTGATGAAACTGGAACCGAGGCAGCGGTCGCAACTGCCGTCGTACTCACGAAAAGAAGTAGAACAGATATGTATTCTTTTGAAGCAGATCATCCGTTTGTATACGCAATCAAAGTTCAAGATGACATTATATTTAGTGGGGTTTTCGTCGGATAA
Protein
MYPEDRVPIDPKYCKGGCLCEDGYVKAKNGTCIPEKECPSCGGDPNAEAGCGINCNRRCSDVGKDPGVCEDDICAVNGCDCKQGYYYDYVSSKCVLPDRCPTTNSSGNVDQSLEKLRRGNMALVGQFLWELYKMNPGQSFVTSPVSVLIPYGQLALYAVGETLDQLLKFINLDNKDQIKKAFPALLKNYRSQTSVLLTVAVKCYGNINYPFTDQFKNDAVTYFDSEGENIDFKYAKQAADTINGWVANKTNNLIQNLVSEDLFSDDTRLVLVDAIYLHGIWQNQFNPNNTHDRDFYITPNKTKSIKTMYQENFFNYGENEILDAQILELFYKGGNSSLVILLPKKKDGLPQMSHKLRNSDEFFNSIKSLRREKVKCFLPKMDIKTNIDMADLSQKMNVTKMFDPQSNDFEGILLNSDPVYVSAAIQKAQIIVDETGTEAAVATAVVLTKRSRTDMYSFEADHPFVYAIKVQDDIIFSGVFVG

Summary

Miscellaneous
The N-terminal section (1-336) is identical to the N-terminal section of the silk moth antitrypsin I (17-352).
Similarity
Belongs to the serpin family.
Keywords
Complete proteome   Direct protein sequencing   Protease inhibitor   Reference proteome   Secreted   Serine protease inhibitor   Signal   3D-structure   Alternative splicing   Glycoprotein  
Feature
chain  Antitrypsin
EMBL
EU935629    ACG61191.1    MG770321    AXY94923.1    RSAL01000018    RVE52848.1    + More
JN033738    AEW46891.2    MG770320    AXY94922.1    KQ460883    KPJ11292.1    NWSH01002542    PCG68017.1    KQ459586    KPI97992.1    JN033737    AEW46890.2    AGBW02015025    OWR40695.1    GDQN01006457    JAT84597.1    KPI97991.1    GDQN01003022    JAT88032.1    GDQN01007288    JAT83766.1    JX524148    AFV46312.1    U58361    AAC47342.1    EU040208    ABW17156.1    HQ615869    ADT63775.1    EU040209    ABW17157.1    AAC47341.1    EU040210    ABW17158.1    AAC47338.1    MG753799    AYC12556.1    RVE52846.1    AAC47335.1    FJ613793    ACT36272.1    D00738    AAC47340.1    L20793    AAA29334.1    AAC47333.1    AB295498    BAF48334.1    EU040207    ABW17155.1    AAC47334.1    KPI97989.1    FJ613794    FJ613796    ACT36273.1    ACT36275.1    FJ613797    ACT36276.1    AK401396    BAM18018.1    AAC47332.1    M23438    L20792    ACT36277.1    ACT36279.1    KR003729    ALD62507.1    AB189029    BAD52261.1    FJ613795    ACT36274.1    MG992370    AXY94808.1    AB295499    BAF48335.1    ACT36278.1    KPJ11294.1    AGBW02009121    OWR51607.1    EU368832    ABY68555.1    ABY68562.1    FJ763763    ACR56864.1    ABY68556.1    JN400442    AFQ01141.1    ABY68558.1    AY148485    AAN71634.1    AY148483    AAN71632.1    AF242200    AAF61252.1    KQ459602    KPI93286.1    ABY68557.1    AY148484    AAN71633.1    RSAL01000236    RVE43711.1    HM357255    ADN52338.1    ABY68563.1    KR003725    ALD62503.1    AGBW02011729    OWR46227.1    ABY68560.1    FJ763764    ACR56865.1    ABY68561.1    ODYU01002062    SOQ39103.1    NWSH01000840    PCG73901.1    EF584499    ABU62829.1    EU935622    ACG61184.1    RVE52836.1    AY829815    AAV91429.1    PCG73906.1    JTDY01000556    KOB76688.1    ODYU01001314    SOQ37342.1    AY150533    AAN73322.1    AY829814    AAV91428.1   
Pfam
PF00079   Serpin        + More
PF01826   TIL
Interpro
IPR023796   Serpin_dom        + More
IPR042185   Serpin_sf_2       
IPR042178   Serpin_sf_1       
IPR000215   Serpin_fam       
IPR036186   Serpin_sf       
IPR036084   Ser_inhib-like_sf       
IPR002919   TIL_dom       
IPR023795   Serpin_CS       
IPR000742   EGF-like_dom       
SUPFAM
SSF56574   SSF56574        + More
SSF57567   SSF57567       
Gene 3D
PDB
1SEK     E-value=3.79165e-59,     Score=579

Ontologies

Topology

Subcellular location
Secreted  
  
Length:
482
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.15592
Exp number, first 60 AAs:
0
Total prob of N-in:
0.00857
outside
1  -  482
 
 

Population Genetic Test Statistics

Pi
179.7112
Theta
165.043365
Tajima's D
-1.069082
CLR
3.583155
CSRT
0.127243637818109
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Peptides ×
Source Sequence Identity Evalue
25860555 QPIQPVSQEDKNDIK 100.00 1e-15
27102218 CYGNINYPFTDQFK 100.00 1e-15
26822097 ESQSCAAVCYEDGCDCK 100.00 3e-11
26822097 CSDIGKEPGACIIICYDNACDCK 100.00 5e-11
24093152 ECPSCGGDPNAEAGCGINCNR 100.00 5e-11
26822097 ECPSCGGDPNAEAGCGINCNRR 100.00 3e-10
24093152 CSDIITDDITK 100.00 3e-10
27102218 SCSQIGK 100.00 3e-10
26822097 DGFYIDTNTGK 100.00 4e-10
24093152 ECPIACPSTCEAPEAKPCKK 100.00 4e-10
26822097 RCSDVGKDPGVCEDDICAVNGCDCK 100.00 3e-06
24093152 DPGATTGGEIIIGGSDPAHYR 100.00 3e-06
26822097 CYGNINYPFTDQFK 100.00 4e-05
25860555 WPEYDPAK 100.00 4e-05
24093152 NCSEIGKPVACPR 100.00 4e-05
27102218 CYGNINYPFTDQFKNDAVTYFDSEGENIDFK 100.00 4e-05
26822097 MIQASSCTQGCICK 100.00 5e-04
25860555 EHDHCTDIIPAGETK 100.00 5e-04
24093152 CYCSCDINSKPVFISIDGSAIKPR 100.00 5e-04
27102218 IKCNQNEVFDICPAPCPPR 100.00 5e-04
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号