SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO13246
Annotation
PREDICTED:_salivary_glue_protein_Sgs-3-like?_partial_[Bombyx_mori]
Location in the cell
Extracellular   Reliability : 1.683 Nuclear   Reliability : 1.899
 

Sequence

CDS
ATGTTGACAAATGCCGTCTTAGTAATGATACAGGCATCTGCCGCATCCACGACCGATACATTTGTAACGGATAAACCTACTTCAGATCCAAGTGCATCTGCTGCATCCACGACCGATACATCTGTAACGGATAAACCCACTTCAGATCCAAGTGCATCTGCCGCATCGACGACCGATACATCTTTAACGGAAAAACCGACTTCAAATCCAAGTGCATCTGCCGCATCGACGACAGATAAATCTGTAACGGATAAACCGACTTCAGATCCAAATGCATCTGCCGCATCGACGACCGATACATCTTTAACGGAAAAACCGACTTCAAATCCAAGTGCATCTGCCGCATCGACGACAGATAAATCTGTAACGGATAAACCGACTTCAGATCCAAATACATCTGCCGCATCCACGACCGATACATTTGTAACGGACAAACCTACTTCAGATCCAAGTGCATCTGCCGCATCGACGACTGATAAATCTGTAATGGATAAACCTACTTCAGATCCAACTGGTAAGTAA
Protein
MLTNAVLVMIQASAASTTDTFVTDKPTSDPSASAASTTDTSVTDKPTSDPSASAASTTDTSLTEKPTSNPSASAASTTDKSVTDKPTSDPNASAASTTDTSLTEKPTSNPSASAASTTDKSVTDKPTSDPNTSAASTTDTFVTDKPTSDPSASAASTTDKSVMDKPTSDPTGK

Summary

Uniprot
ProteinModelPortal

Ontologies

GO

Topology

Length:
173
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00249
Exp number, first 60 AAs:
0.00249
Total prob of N-in:
0.06638
outside
1  -  173
 
 

Population Genetic Test Statistics

Pi
423.637153
Theta
176.455956
Tajima's D
4.407313
CLR
6.747494
CSRT
0.9998000099995
Interpretation
Possibly Balancing Selection

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号