SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO13245
Annotation
hypothetical_protein?_partial_[Plasmodium_yoelii_yoelii_17XNL]
Location in the cell
Nuclear   Reliability : 2.155
 

Sequence

CDS
ATGACAGACAAACCTGTAACGGATAAACCTACTTCAGATCCAAGTGCATCCGCCGCATCCACCACAGATAAATCTGTAACGGACAAACCTACTTCACATCCAAGTGCATCTGCTGCATCGACGACCGATACATCTGTATCAGACAAACTTACTTCAAATCCAAGTGCATCTGCCACATCCAGGACAGATAAATCTGTAACGGATAAACCTACTTCAGATCCAAGTGCATCTGCCGCATGGACGACCGATACATTTGTAACGAATAAACCTACTTCAGACCCAAGTGCATCTGCGGCATCGACGACCGATACATCTGTAACGGATAATCCTACTTCAGATCCAAGTGCATCTGCCGCATCGACGACCGATACATCTGTAACGGATAAACCTACTTCAGATCCAAGTGCATCTACCGCATCGACGACCGATACATCTGTAACGGATAAACCTACTTCAGATCCAAGTGCATCTGCCGCATCCACGACAGACAAATCTGTAACGGATAAACCTACTTCAGATCCAAGTGCATCTGCCGCATCGACGACCGATATATCTGTAACGGATAAACCTACTTCAGATCCAAGTGCATCTGCCGCATCCACGACAGACAAATCTGTAACGGATAAACCTACTTCAGATCCAAGTGCATCTGCCGCATCGACGACCGATATATCTGTAACGGATAAACCTACTTCAGATCCAAGTGCATCTGCCGCATCCACGACAGACAAATCTGTAACGGATAAACCTACTTCAGATCCAAGTGCATCTGCCGCATCGACGACCGATACATCTGTAACGGATAAACCTACTTCAGATCCAAGTGCATCTGCCGCATCCACGACAGACAAATCTGTAACGGATAAACCTACTTCAGATCCAAGTGCATCTGCCGCATCCACGACAGACAAATCTGTAACGGATAAACCTACTTCAGATCCAAGTGCATCTGCCGCATCCACGACAGACAAATCTGTAACGGATAAACCTACTTCAGATCCAAGTGCATCTGCCGCATCGACGACCGATACATCTGTAACGGATAAACCTACTTCAGATCCAAGTGCGTCTGCCGCATCCACGACAGACAAATCTGTAACGGATAAACCTACTTCAGATCCAAGTGCATCTGCCGCATCGACGACCGATACATCTGTAACGGATAAACCTACTTCAGATCCAAGTGCATCTGCCGCATCCACGACAGACAAATCTGTAACGGATAAACCTACTTCAGATCCAAGTGCATCTGCCGCATCGACGACCGATATATCTGTAACGGATAAACCTACTTCAGATCCAAGTGCATCTGCCGCGTCCACGACAGACAAATCTGTAACGGATAAACCCACTGCAGATCCAAGTGCATCTGCCGCATCGACGACAGATAAATCTGTAACGGATAAACCGACTTCAGATCCAAATGCATCTGCCGCATCCACGACCGATACATTTGTAACGGATAAACCTACTTCAGATCCAAGTGCATCTGCCGCATCCACGACAGACAAATCTGTAACGGATAAACCTACTTCAGATCCAAGTGCATCTGCCGCATCGACGACCGATACATCTGTAACGGATAAACCTACTTCAGATCCAAGTGCATCTGCCGCATCGACGACAGATAAATCTGTAACGGATAAACCGACTTCAGATCCAAATGCATCTGCCGCATCGACGACCGATACATCTGTAACGGATAAACCTACTTCAGATCCAAGTGCGTCTGCCGCATCCACGACAGACAAATCTGTAACGGATAAACCTACTTCAGATCCAAGTGCATCTGCCGCATCCACGACAGACAAATCTGTAACGGATAAACCTACTTCAGATCCAAGTGCATCTGCCGCATCGACGACCGATATATCTGTAACGGATAAACCTACTTCAGATCCAAGTGCATCTGCCGCGTCCACGACAGACAAATCTGTAACGGATAAACCCACTGCAGATCCAAGTGCATCTGCCGCATCGACGACAGATAAATCTGTAACGGATAAACCGACTTCAGATCCAAATGCATCTGCCGCATCCACGACCGATACATTTGTAACGGATAAACCTACTTCAGATCCAAGTGCATCTGCCGCATCCACGACAGACAAATCTGTAACGGATAAACCTACTTCAGATCCAAGTGCATCTGCCGCATCGACGACCGATACATCTGTAACGGATAAACCTACTTCAGATCCAAGTGCATCTGCCGCATCGACGACAGATAAATCTGTAACGGATAAACCGACTTCAGATCCAAATGCATCTGCCGCATCGACGACCGATACATCTGTAACGGAAAAACCTACTTCAGATCCAAGTGCGTCTGCCGCATCCACGACAGACAAATCTGTAACGGATAAACCTACTTCAGATCCAAGTGCATCCGCCGCATCCACGACAGACAAATCTGTAACGGATAAACCTATTTCAGATCCAAGTGCATCTGCCGCGTCCACGACAGACAAATCTGTAACGGATAATCCTACTTCAGATCCAAGTGCATCTGCCGCGTCCACGACAGACAAATCTGTAACGGATAATCCTACTTCAGATCCAAGTGCATCTGCCGCATCCACAACCGATACATTTGTAACGGATAAACCTACTTCAGATCCAAGTGCATCTGCCGCATCCACGACAGACAAATCTGTAACGGATAAACCTACTTCAGATCCAAGTGCATCTGCCGCATCGACGACAGATAAATCTGTAACGGATAAACCGACTTCAGATCCAAATGGTAAGTTTCCATAA
Protein
MTDKPVTDKPTSDPSASAASTTDKSVTDKPTSHPSASAASTTDTSVSDKLTSNPSASATSRTDKSVTDKPTSDPSASAAWTTDTFVTNKPTSDPSASAASTTDTSVTDNPTSDPSASAASTTDTSVTDKPTSDPSASTASTTDTSVTDKPTSDPSASAASTTDKSVTDKPTSDPSASAASTTDISVTDKPTSDPSASAASTTDKSVTDKPTSDPSASAASTTDISVTDKPTSDPSASAASTTDKSVTDKPTSDPSASAASTTDTSVTDKPTSDPSASAASTTDKSVTDKPTSDPSASAASTTDKSVTDKPTSDPSASAASTTDKSVTDKPTSDPSASAASTTDTSVTDKPTSDPSASAASTTDKSVTDKPTSDPSASAASTTDTSVTDKPTSDPSASAASTTDKSVTDKPTSDPSASAASTTDISVTDKPTSDPSASAASTTDKSVTDKPTADPSASAASTTDKSVTDKPTSDPNASAASTTDTFVTDKPTSDPSASAASTTDKSVTDKPTSDPSASAASTTDTSVTDKPTSDPSASAASTTDKSVTDKPTSDPNASAASTTDTSVTDKPTSDPSASAASTTDKSVTDKPTSDPSASAASTTDKSVTDKPTSDPSASAASTTDISVTDKPTSDPSASAASTTDKSVTDKPTADPSASAASTTDKSVTDKPTSDPNASAASTTDTFVTDKPTSDPSASAASTTDKSVTDKPTSDPSASAASTTDTSVTDKPTSDPSASAASTTDKSVTDKPTSDPNASAASTTDTSVTEKPTSDPSASAASTTDKSVTDKPTSDPSASAASTTDKSVTDKPISDPSASAASTTDKSVTDNPTSDPSASAASTTDKSVTDNPTSDPSASAASTTDTFVTDKPTSDPSASAASTTDKSVTDKPTSDPSASAASTTDKSVTDKPTSDPNGKFP

Summary

Uniprot
ProteinModelPortal

Ontologies

GO

Topology

Length:
919
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0
Exp number, first 60 AAs:
0
Total prob of N-in:
0.00002
outside
1  -  919
 
 

Population Genetic Test Statistics

Pi
300.037091
Theta
176.187507
Tajima's D
1.865348
CLR
12.470773
CSRT
0.861006949652517
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号