SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO13131
Annotation
PREDICTED:_uncharacterized_protein_LOC105842558_[Bombyx_mori]
Location in the cell
Nuclear   Reliability : 2.37
 

Sequence

CDS
ATGCTCAGGGAGGATTCGGTTAGACGTTCAATGCAACCACCTTACTCTGGTCCTCATAGAGTTATATCTAGAGCCGAGGACGGAAAAACGTGGTCGATTGATGTAAAAGGGAAACAGGTGACGGTCAGTGTCGACAGAATTAAGCCAGCTTTCGTCGAGCATTCTTTAGTAGATCTCGTTCCAGCACCAGCACCGCGGGTTTCTGTGCCTCAACCAGCGCAACCGGATGCTACTAATGTCCCTTCATGTCCACTCGTGCCTTCGGCACCTCTAACTGCTACTCCTACACATACACCTCAATATACCACCCGGTCAGGTCGCAGAGTCCACTTCTCCAAACCTTTCGACCTATGA
Protein
MLREDSVRRSMQPPYSGPHRVISRAEDGKTWSIDVKGKQVTVSVDRIKPAFVEHSLVDLVPAPAPRVSVPQPAQPDATNVPSCPLVPSAPLTATPTHTPQYTTRSGRRVHFSKPFDL

Summary

Pfam
PF17917   RT_RNaseH        + More
PF00665   rve
PF17921   Integrase_H2C2
PF17919   RT_RNaseH_2
PF00078   RVT_1
Interpro
IPR036397   RNaseH_sf        + More
IPR012337   RNaseH-like_sf       
IPR001584   Integrase_cat-core       
IPR041373   RT_RNaseH       
IPR041588   Integrase_H2C2       
IPR021109   Peptidase_aspartic_dom_sf       
IPR001995   Peptidase_A2_cat       
IPR041577   RT_RNaseH_2       
IPR001969   Aspartic_peptidase_AS       
IPR034132   RP_Saci-like       
IPR000477   RT_dom       
SUPFAM
SSF53098   SSF53098        + More
SSF50630   SSF50630       
Gene 3D

Ontologies

Topology

Length:
117
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00019
Exp number, first 60 AAs:
0
Total prob of N-in:
0.38140
outside
1  -  117
 
 

Population Genetic Test Statistics

Pi
197.100519
Theta
126.771406
Tajima's D
1.639035
CLR
0
CSRT
0.816709164541773
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号