SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO12774  Validated by peptides from experiments
Pre Gene Modal
BGIBMGA007153
Annotation
PREDICTED:_uncharacterized_family_31_glucosidase_KIAA1161_[Bombyx_mori]
Location in the cell
Cytoplasmic   Reliability : 1.057 Lysosomal   Reliability : 1.505
 

Sequence

CDS
ATGAAGTGGTTGCTGCTGCTCACAGGAGTCACGGTAGCGCTCTGCGCTATACCAAAAGCACCCCTACAACGCGACGTACTGGTGGAAGAACATGAAGACGGAGGACTTCTTTTATCTGCCATATCTGCAAGCACCACTTTACTGACCGGCCACATTGGTCGTCGTGTGGCTTCTGATGATGAGGAGGTAATCTTCGATATCAACACAGCCTACGATGAAGAGTCCGGTGGCTACCGCATTAGCATACATTGGGATGGACCTGCGGACCGAGTTTTTGAAGACTGCTTCAACTTTGGTTCCCTTCAATGGTACGGTGGTCCTGAACAAAAGCAACAGTACTGGCCGATTCAAAACAGCAACCTGCAAAAATACTCAATCATATCCAAAGAGGAAGACAATTCCGCTGTATCGGAACGCTACTGGTTAAACTCGGCCGGCCAATACTTCTACGTGCAACCCGAAGCGCCCCTCTTCATTGACTACCATAACGTCGAGGACAACCACATTTGCTTCATCGCCGAAGTGGCGGCTCCCTATTCCAGTAAACGCACACATAACAGCCTCAAATACGATATCTGGTTCTTTGAAAACGCAAAGGTCGCGCACCAACACGCTGTAGACACTTATCTAGGAAAACCTACAGGCTTGCCTGATTACAGAATGATTCAATACCCAGTCTTCTCGACTTGGGCGAGATATTCCCGTGGAATAGACAGGGACAGCCTTTGGGCTTTTGCTAACGAGATCAAGGATACCGGATTTCCAAACGCTCAGTTTGAAATCGATGACCTTTGGGAGATCTGTTACGGATCTTTGACTGTTGATGAGAGGAAGCTGCCTGACTTTAAAGGTCTTATCCAGGAAATTAAGAGCTTAGGCTTCAGGGTCACAATTTGGGTACATCCGTTCATCAACAAGAATTGCGAGCCGTGGTTTTCTGATGCTTTGGAGAAAGGCTACCTTGTCCTCAACGAAGAAGGCAACCCTGAATCTACCTGGTGGAACAACAACGGCTCTTTACCCGGGTACATTGACTTCACCAACCCTGATGCTGCAGAATGGTACACGTCAAGGATCCAAGATCTTATTGATACCTACGATATTGACAGCCTGAAGTTCGACGCTGGCGAATCTAGTTGGTCTCCACAGATTCCAGTACAGAACGGCGACATTGATCTCCATCCTGGTCACGTGGTTGAGTCTTACGTGAGAGCCGTTGCCAAGTTCGGCCCAATGATCGAGATCAGAGCGGGCATGAGAACCCAAGACCTCCCAGTCTTCGTCCGCATGGTTGACAAAGACACCCTTTGGGACTTCAACAACGGTCTCGCGACGTTGGTCACGACTCTATTGCAAATGAACCTCAACGGGTACACGTTGGTGCTGCCTGATATGATCGGAGGAAATGGTTATAATGAGTCTCCGAGTAAGGAGTTGCTGGTGAGGTGGCTACAGGCTAATGTCTTCATGCCGACGCTTCAATACTCGTTTGTGCCCTGGGATCATGATGAAGAGGCAGTAGAAATCTGCCGCAAATACACGCATCTTCACGCCGAATATGCTGATGAGATCGTGGCCGCTATGGAGGCGTCCATCCAAAAAGGAACTCCCGTGAACCCTCCCATCTGGTGGTTGGATCCTACCGACCAGGACGCTTTGGCTGTTTGGGACGAGTTCTTGTTAGGAGAGCGCGTGCTGGCTGCCCCGGTACTGCAGCAGGGCGCCGTGTCCCGGGACGTGTATCTGCCGCGCGGCTCCTGGCGGGACGGCGTCACCGGGGAGCTTCACCAGGGTCCACTGTGGCTACGGGACTACCCGGCACCACTAGACACGCTGCCTTACTTCACTCTCGAAGACTAG
Protein
MKWLLLLTGVTVALCAIPKAPLQRDVLVEEHEDGGLLLSAISASTTLLTGHIGRRVASDDEEVIFDINTAYDEESGGYRISIHWDGPADRVFEDCFNFGSLQWYGGPEQKQQYWPIQNSNLQKYSIISKEEDNSAVSERYWLNSAGQYFYVQPEAPLFIDYHNVEDNHICFIAEVAAPYSSKRTHNSLKYDIWFFENAKVAHQHAVDTYLGKPTGLPDYRMIQYPVFSTWARYSRGIDRDSLWAFANEIKDTGFPNAQFEIDDLWEICYGSLTVDERKLPDFKGLIQEIKSLGFRVTIWVHPFINKNCEPWFSDALEKGYLVLNEEGNPESTWWNNNGSLPGYIDFTNPDAAEWYTSRIQDLIDTYDIDSLKFDAGESSWSPQIPVQNGDIDLHPGHVVESYVRAVAKFGPMIEIRAGMRTQDLPVFVRMVDKDTLWDFNNGLATLVTTLLQMNLNGYTLVLPDMIGGNGYNESPSKELLVRWLQANVFMPTLQYSFVPWDHDEEAVEICRKYTHLHAEYADEIVAAMEASIQKGTPVNPPIWWLDPTDQDALAVWDEFLLGERVLAAPVLQQGAVSRDVYLPRGSWRDGVTGELHQGPLWLRDYPAPLDTLPYFTLED

Summary

Similarity
Belongs to the glycosyl hydrolase 31 family.
EMBL
BABH01031610    BABH01031611    DQ515931    ABF71570.1    RSAL01000164    RVE45338.1    + More
AGBW02009556    OWR50521.1    KQ458981    KPJ04460.1    LADJ01009642    KPJ20937.1    NWSH01001097    PCG72627.1    KZ150013    PZC75027.1    ODYU01001088    SOQ36836.1    RVE45337.1    OWR50520.1    PZC75028.1    JTDY01003042    KOB70265.1    PCG72626.1    BABH01031586    LADJ01000497    KPJ20835.1    PZC75030.1    PCG72625.1    RVE45336.1    OWR50519.1    PYGN01002153    PSN31308.1    KJ576837    AIA09350.1    BABH01031581    BABH01031582    BABH01031583    HQ015443    ADL40394.1    GAKP01007549    JAC51403.1    GDHF01025510    JAI26804.1    GDHF01029666    JAI22648.1    GFDF01005277    JAV08807.1    GFDF01005272    JAV08812.1    GFDF01005301    JAV08783.1    GFDF01005271    JAV08813.1    GAMC01013151    JAB93404.1    GANO01003733    JAB56138.1    APCN01002678    APCN01002679    GECZ01007254    JAS62515.1    PZC75029.1    CH964272    EDW84817.1    GECU01028408    JAS79298.1    JRES01001582    KNC21726.1    AAAB01008978    EAA43680.4    LBMM01005028    KMQ91888.1    KA646719    AFP61348.1    UFQS01000448    UFQT01000448    SSX04071.1    SSX24436.1    KK853055    KDR11965.1    AXCN02001904    AXCM01014517    UFQT01000758    SSX27019.1    UFQS01000118    UFQT01000118    SSW99999.1    SSX20379.1    AJVK01030572    AJVK01030573    AJVK01030574    GEBQ01008596    JAT31381.1    GEDC01025706    JAS11592.1    GFDL01004729    JAV30316.1    CH477301    EAT44243.1    ADTU01011323    ADTU01011324    DS232644    EDS44382.1    CH940650    EDW66712.1    KQ976500    KYM83170.1    GEZM01063873    JAV68942.1    JXUM01114446    KQ565787    KXJ70664.1    KQ981673    KYN38385.1    KK107459    EZA50367.1    QOIP01000004    RLU24248.1    CH916369    EDV93512.1    KQ979433    KYN21584.1    CH902617    EDV42621.1    KQ982373    KYQ57031.1    GL888932    EGI57171.1    GL448504    EFN84538.1    OUUW01000008    SPP83988.1    SPP83989.1    CM000364    EDX14422.1    CH933806    EDW15828.1    KQ978068    KYM97553.1    ATLV01020585    KE525303    KFB45426.1    KYQ57032.1    EDW83817.1    CM000070    EAL29004.2    CVRI01000058    CRL02784.1    GEZM01006957    JAV95530.1    ADMH02002112    ETN58830.1    GFDL01006647    JAV28398.1   
Pfam
PF01055   Glyco_hydro_31        + More
PF12416   DUF3668
Interpro
IPR000322   Glyco_hydro_31        + More
IPR013780   Glyco_hydro_b       
IPR017853   Glycoside_hydrolase_SF       
IPR035892   C2_domain_sf       
IPR022136   DUF3668       
SUPFAM
SSF51445   SSF51445       
Gene 3D
PDB
5I0F     E-value=6.19458e-22,     Score=259

Ontologies

Topology

SignalP
Position:   1 - 15,         Likelihood:  0.983403
 
 
Length:
619
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.10612
Exp number, first 60 AAs:
0.0959100000000001
Total prob of N-in:
0.00464
outside
1  -  619
 
 

Population Genetic Test Statistics

Pi
7.805933
Theta
18.25592
Tajima's D
-1.667619
CLR
38.425515
CSRT
0.0408479576021199
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Peptides ×
Source Sequence Identity Evalue
28556443 FDAGESSWSPQIPVQNGDIDLHPGHVVESYVR 100.00 3e-16
28556443 DYPAPLDTLPYFTL 100.00 3e-16
28556443 DYPAPLDTLPYFTL 100.00 3e-16
28556443 MIQYPVFSTWA 100.00 3e-11
28556443 KYTHLHAEYADEIVAAMEASIQK 100.00 9e-10
28556443 ISIHWDGPADR 100.00 9e-10
28556443 IQDLIDTYDIDSLK 100.00 9e-10
28556443 VAHQHAVDTYLGKPTGLPDYR 100.00 3e-09
28556443 VAHQHAVDTYLGKPTGLPDYR 100.00 3e-09
28556443 VAHQHAVDTYLGKPTGLPDYR 100.00 3e-09
28556443 VAHQHAVDTYLGK 100.00 3e-09
28556443 VAHQHAVDTYLGK 100.00 3e-09
28556443 VAHQHAVDTYLGKPTGLPDYR 100.00 5e-09
28556443 YTHLHAEYADEIVAAMEASIQK 100.00 6e-09
28556443 YTHLHAEYADEIVAAMEASIQK 100.00 6e-09
28556443 YTHLHAEYADEIVAAMEASIQK 100.00 6e-09
28556443 YSIISK 100.00 6e-09
28556443 YDIWFFENAK 100.00 6e-09
28556443 QQYWPIQNSNLQK 100.00 3e-07
28556443 SFVPWDHDEEAVEICR 100.00 3e-07
28556443 YTHLHAEYADEIVAAMEASIQK 100.00 3e-05
28556443 DGVTGELHQGPLWLR 100.00 3e-04
28556443 DGVTGELHQGPLWLR 100.00 3e-04
28556443 DGVTGELHQGPLWLR 100.00 3e-04
28556443 DGVTGELHQGPL 100.00 3e-04
28556443 VVITEVTPEGHFYAQNVDLGVK 100.00 3e-04
28556443 ISIHWDGPADR 100.00 0.001
28556443 VAHQHAVDTYLGK 100.00 0.004
28556443 TYDIDSLK 100.00 0.004
28556443 TQDLPVFVR 100.00 0.004
28556443 DYPAPLDTLPYFTL 100.00 0.006
28556443 DVYLPR 100.00 0.006
28556443 DSLWAFANEIK 100.00 0.006
28556443 IQDLIDTYDIDSLK 100.00 0.016
28556443 IQDLIDTYDIDSLK 100.00 0.016
28556443 IAEVAAPYSSK 100.00 0.016
28556443 FGPMIEIR 100.00 0.016
28556443 MIQYPVFS 100.00 0.019
28556443 STTLLTGHIGR 100.00 0.019
28556443 QQYWPIQNSNLQK 100.00 0.022
28556443 QQYWPIQNSNLQK 100.00 0.022
28556443 QQYWPIQNSNLQK 100.00 0.022
28556443 NCEPWFSDALEK 100.00 0.022
28556443 NCEPWFSDALEK 100.00 0.022
28556443 NCEPWFSDALEK 100.00 0.030
28556443 NCEPWFSDALEK 100.00 0.030
28556443 MIQYPVFSTWAR 100.00 0.030
28556443 MIQYPVFSTWAR 100.00 0.030
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号