SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO12751
Annotation
PREDICTED:_uncharacterized_protein_LOC101737183_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 1.471 Peroxisomal   Reliability : 1.014 PlasmaMembrane   Reliability : 1.258
 

Sequence

CDS
ATGGTTACTGTCATACGCAGGGTCCGCCTGCGGGCTCGCTCTAACAGACTCCTGTCTGATCTCCGAAGGCGCACGGGCTTAAGTCCGCTGTGACTCGTGCTGTTGAGAAAGGAAGGGCGCCCGGCGGATACTGCCGCCGGGTACCGTCCCATCGTGTTGCTGGATGAGGTGGGCAAGCTGCTGGAACGCATTCTGGCGGCCCGCATCATCCAGCATCTGGTCAGGGTGGGACCCAATCTGTCGGCGGAGCAGTATGGCTTCCGAGAGGGCCGCTCAACGGTAGACGCGATCCTTCGCGTGCGGGCCCTCTCAGAGGAGGCCGTCTCCAGGGGTGGGGTGGCTTTGGCGGTGTCGCTCGACATCGCCAATGCTTTTAACACCCTGCCCTGGTCCGTGATAAGGGGGGCGCTGGAACGACATGGAGTGCCTCCCTACCTTCGCCGGCTGGTGGGTTCCTACTTGGAGGACAGATCGGTCACGTGTACCGGACACGGTGGGATCCTGCACCGGTTCCCGGTCGTGCGCGGTGTTCCACAGGGGTCGGTGCTCGGCCCCCTTTTGTGGAATATCGGGTATGACTGGGTGCTGAGAGGTGCCCTCCTCCCGGGCCTGAGCGTAATCTGTTACGCAGACGACAAGTTGGTCGTGGCCCGGGGGGGTAGTTTTGCCGAGTCTGCCCGTCTTGCTACCGCTGGGGTGGCGCATGTCGTCGGCAAAATCAGGAGATTGGGCCTCGACGTGGCGCTCAGTAAATCCGAGGCCATGTGGTTCCACAGGCCCCGGAGAGTGCCACCTGTCGATGCCCATATCGTGGTTGGAGGCGTTCGTATCGGGGTCGGGGTTCAGTTGAAGTACCTCGGCCTCATTCTGGACAGTCGTTGGACCTTTCGTGCTCACTTTCAGAGCCTGGTCCCTCGTTTGTTGGGGGTGGCCGGCGCGTTAAGCCGGCTTCTGTCCAACGTCGGGGGGCCTGACCAGGTGACGCGCCGTCTCTATACGGGGGTGGTGCGATCAATGGCCCTATACGGGGCACCTGTGTGGGGCCAGTCCCTGGTCGCGGGGGTGGCGAAGCTGCTGCAACGGCCGCAACGCACCATCGCGGTCAGGGTCATTCGTGGTTATCGCACCATCTCCTTTGAGGCGGCGTGTGTACTGGCTGGGACGCCGCCTTGA
Protein
MVTVIRRVRLRARSNRLLSDLRRRTGLSPLXLVLLRKEGRPADTAAGYRPIVLLDEVGKLLERILAARIIQHLVRVGPNLSAEQYGFREGRSTVDAILRVRALSEEAVSRGGVALAVSLDIANAFNTLPWSVIRGALERHGVPPYLRRLVGSYLEDRSVTCTGHGGILHRFPVVRGVPQGSVLGPLLWNIGYDWVLRGALLPGLSVICYADDKLVVARGGSFAESARLATAGVAHVVGKIRRLGLDVALSKSEAMWFHRPRRVPPVDAHIVVGGVRIGVGVQLKYLGLILDSRWTFRAHFQSLVPRLLGVAGALSRLLSNVGGPDQVTRRLYTGVVRSMALYGAPVWGQSLVAGVAKLLQRPQRTIAVRVIRGYRTISFEAACVLAGTPP

Summary

Similarity
Belongs to the AB hydrolase superfamily. Lipase family.
EMBL
AB090825    BAC57926.1    AB078935    BAC06462.1    AB078929    BAC06452.1    + More
AB078931    BAC06456.1    AB078930    BAC06454.1    D85594    BAA19776.1    KZ149896    PZC78733.1    LBMM01012027    KMQ86470.1    LBMM01024063    KMQ82623.1    KQ460685    KPJ12887.1    AB078936    BAC06464.1    RSAL01000481    RVE41577.1    LBMM01015565    KMQ84759.1    LBMM01006063    KMQ90967.1    LBMM01006954    KMQ90166.1    LBMM01005948    KMQ91066.1    LBMM01003575    KMQ93366.1    LBMM01006671    KMQ90407.1    LBMM01004262    KMQ92649.1    LBMM01004272    KMQ92618.1    LBMM01004261    KMQ92650.1    LBMM01008448    KMQ88867.1    LBMM01005733    KMQ91252.1    LBMM01007036    KMQ90099.1    LBMM01006657    KMQ90417.1    LBMM01004634    KMQ92224.1    LBMM01008422    KMQ88894.1    LBMM01002052    KMQ95336.1    LBMM01019839    KMQ83438.1    LBMM01008682    KMQ88705.1    LBMM01019838    KMQ83439.1    GGMR01000779    MBY13398.1    LBMM01003245    KMQ93755.1    LBMM01003988    KMQ92922.1    LBMM01007425    KMQ89740.1    LBMM01003001    KMQ94088.1    LBMM01006725    KMQ90373.1    LBMM01013668    KMQ85535.1    LBMM01008445    KMQ88871.1    LBMM01015018    KMQ84954.1    QOIP01000014    RLU15074.1    LBMM01012322    LBMM01012138    KMQ86282.1    KMQ86387.1    LBMM01015025    KMQ84953.1    LBMM01015285    KMQ84870.1    LBMM01013923    KMQ85417.1    LBMM01002480    KMQ94776.1    LBMM01005465    KMQ91492.1    LBMM01012412    KMQ86235.1    KMQ94772.1    LBMM01008226    KMQ89040.1    LBMM01008278    KMQ89009.1    LBMM01014122    KMQ85315.1    LBMM01004505    KMQ92346.1    LBMM01005474    KMQ91485.1    LBMM01006857    KMQ90264.1    GGMR01014195    MBY26814.1    LBMM01009610    KMQ87992.1    LBMM01014956    KMQ84982.1    LBMM01006977    KMQ90149.1    GGMR01009778    MBY22397.1    GGMR01015159    MBY27778.1    LBMM01004603    KMQ92250.1    ABLF02015311    ABLF02015320    ABLF02034009    ABLF02043484    LBMM01009535    KMQ88053.1    LBMM01005845    KMQ91162.1    GGMR01006838    MBY19457.1    ABLF02004920    ABLF02004921    ABLF02015191    ABLF02016615    ABLF02024214    GEBQ01030504    JAT09473.1    ABLF02034925    ABLF02011136    ABLF02014426    ABLF02011238    LBMM01004344    KMQ92531.1    LBMM01005216    KMQ91703.1    GGFJ01001439    MBW50580.1    ABLF02041557    LBMM01008066    KMQ89173.1    AAZX01001144    GGFJ01001369    MBW50510.1    GGFL01001916    MBW66094.1    GGFJ01001727    MBW50868.1    ABLF02023257    ABLF02004674    ABLF02004675    ABLF02004676    ABLF02011637    GGFJ01001370    MBW50511.1    KU543683    AMS38371.1    ABLF02009991    ABLF02009992    ABLF02054952    GGFJ01001541    MBW50682.1    HACL01000281    CFW94575.1   
Pfam
PF14529   Exo_endo_phos_2        + More
PF00078   RVT_1
PF03372   Exo_endo_phos
PF01553   Acyltransferase
PF07776   zf-AD
PF00096   zf-C2H2
PF00151   Lipase
PF00098   zf-CCHC
PF13966   zf-RVT
Interpro
IPR000477   RT_dom        + More
IPR036691   Endo/exonu/phosph_ase_sf       
IPR005135   Endo/exonuclease/phosphatase       
IPR002123   Plipid/glycerol_acylTrfase       
IPR012934   Znf_AD       
IPR013087   Znf_C2H2_type       
IPR036236   Znf_C2H2_sf       
IPR001878   Znf_CCHC       
IPR036875   Znf_CCHC_sf       
IPR029058   AB_hydrolase       
IPR013818   Lipase/vitellogenin       
IPR000734   TAG_lipase       
IPR026960   RVT-Znf       
SUPFAM
SSF56219   SSF56219        + More
SSF57667   SSF57667       
SSF57756   SSF57756       
SSF53474   SSF53474       
Gene 3D
PDB
6AR3     E-value=3.73457e-05,     Score=112

Ontologies

Topology

Subcellular location
Secreted  
Length:
390
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
1.26613
Exp number, first 60 AAs:
0.00125
Total prob of N-in:
0.04388
outside
1  -  390
 
 

Population Genetic Test Statistics

Pi
0.028926
Theta
0.427991
Tajima's D
-1.357889
CLR
126.179965
CSRT
0
Interpretation
Possibly Positive selection

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号