SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO12677
Annotation
endonuclease-reverse_transcriptase_[Bombyx_mori]
Location in the cell
Nuclear   Reliability : 3.343
 

Sequence

CDS
ATGGTAGTTTCAAGAAACCCGGATTTGAGTTCAAGCGTATCTGTAGCTGGGAAACAACTAGAGCGGGTACGACAGTACAAGTATTTAGGAGCTTGGGTAAATGAAGCATGGGAATCTGATCAAGAAATCAAGACCCGGATAGAAACTGCTCAAGCCTCTTTTAATAAAATGAGGAAAGTTCTTTGCTGTCTTCAACTGAATATAAAGCTCCGAGTCAGGCTACTCATGTGCTATATCTGGCCTATCGTCATGTATGGTTGCGAAACGTGGACCCTGAAAGAGGACACTACAAGACGCCTACAGGCATTCGAGATGTGGTGCTACCGTCGCATGTTACGCATTAGTTGGACGCAGAGGGTCAGGAACGAAACCGTGCTTCAGCGCGTTCATATGTCCCGGAAAATGTTGCCTTCTATCAAAAAGCGCAAGACAGAGTATCTCGGCCACGTGCTCAGGAACGATCGATACATGCTGCTGCAGCTGATAATTATGGGCAAAATGGACGGAAAGAGACGTGCTGGGCGAAGAAAAAAGTCATGGCTCCGGAATATCCGGGAGTGGACCGGTATTGCATCCGTCGAACAGCTGTTCCAGCTGGCTGCTGACAGAAAAGAATACAGGAAGCTAACGGCCAACCTTCAGGATTGA
Protein
MVVSRNPDLSSSVSVAGKQLERVRQYKYLGAWVNEAWESDQEIKTRIETAQASFNKMRKVLCCLQLNIKLRVRLLMCYIWPIVMYGCETWTLKEDTTRRLQAFEMWCYRRMLRISWTQRVRNETVLQRVHMSRKMLPSIKKRKTEYLGHVLRNDRYMLLQLIIMGKMDGKRRAGRRKKSWLRNIREWTGIASVEQLFQLAADRKEYRKLTANLQD

Summary

EMBL
GU815089    ADF18552.1    NWSH01002736    PCG67606.1    GDHC01017214    JAQ01415.1    + More
GBHO01028834    JAG14770.1    GBHO01020011    GDHC01013600    JAG23593.1    JAQ05029.1    LBMM01003995    KMQ92919.1    LBMM01001656    KMQ95932.1    GGMS01004979    MBY74182.1    NWSH01001998    PCG69477.1    GAIX01014959    JAA77601.1    GBRD01005612    JAG60209.1    GGMR01005851    MBY18470.1    HACG01049248    HACG01049253    CEK96113.1    CEK96118.1    HACG01049251    HACG01049252    CEK96116.1    CEK96117.1    HACG01049244    HACG01049247    CEK96109.1    CEK96112.1    HACG01049255    CEK96120.1    HACG01049245    CEK96110.1    HACG01049249    CEK96114.1    GL453752    EFN75584.1    NEVH01004403    PNF39833.1    NEVH01008300    PNF34184.1    NEVH01013201    PNF29989.1    NEVH01025635    PNF15414.1    NEVH01017535    PNF24084.1    NEVH01017441    PNF24607.1    NEVH01020333    PNF21801.1    GGMS01001437    MBY70640.1    NEVH01026391    PNF14322.1    NEVH01018384    PNF23448.1    NEVH01000001    PNF44158.1    NEVH01010478    PNF32508.1    NEVH01002157    PNF42414.1    NEVH01001374    PNF42669.1    NEVH01023953    PNF17874.1    NEVH01001347    PNF42965.1    NEVH01001337    PNF43070.1    NEVH01002549    PNF42160.1    NEVH01016330    PNF25584.1    NEVH01020870    PNF20747.1    GGMR01016842    MBY29461.1    ABLF02038495    NEVH01009381    PNF33254.1    NEVH01013652    PNF28353.1    NEVH01016329    PNF25648.1    NEVH01015318    PNF26901.1    NEVH01010487    PNF32335.1    NEVH01003750    PNF40097.1    NEVH01026085    PNF14958.1    NEVH01009076    PNF33845.1    NEVH01002728    PNF41343.1    NEVH01020956    NEVH01016294    NEVH01011197    NEVH01009765    NEVH01003008    PNF20357.1    PNF26083.1    PNF31821.1    PNF32947.1    PNF40845.1    NEVH01002684    PNF41750.1    NEVH01000257    PNF43803.1    NEVH01013563    PNF28562.1    NEVH01015308    PNF27027.1    NEVH01017534    PNF24114.1    NEVH01012081    PNF31013.1    NEVH01020868    PNF20801.1    NEVH01009907    PNF32598.1    NEVH01020867    PNF20816.1    NEVH01011876    PNF31501.1    NEVH01000295    PNF43662.1    PNF14932.1    NEVH01026122    PNF14543.1    NEVH01007419    PNF35717.1    NEVH01004413    PNF39563.1    ABLF02046942    ABLF02059971    NEVH01013210    PNF29764.1    NEVH01020856    PNF21059.1    NEVH01007405    PNF35773.1    NEVH01007819    PNF35377.1    NEVH01024189    PNF17475.1    NEVH01009772    PNF32674.1    NEVH01018411    PNF23333.1    NEVH01013245    PNF29434.1    NEVH01025651    PNF15155.1    NEVH01008283    PNF34242.1    NEVH01019967    PNF22088.1    PNF42173.1    NEVH01006565    PNF37921.1    NEVH01024952    PNF16338.1    NEVH01005288    PNF38924.1    NEVH01002574    PNF41923.1    NEVH01015827    PNF26505.1    NEVH01012097    PNF30370.1    PNF16321.1    NEVH01002690    PNF41636.1    PNF31014.1    NEVH01017443    PNF24479.1    NEVH01017570    PNF23798.1    GGMS01001369    MBY70572.1    NEVH01003494    PNF40693.1    NEVH01025174    PNF15486.1    NEVH01027104    PNF13657.1    NEVH01002704    PNF41497.1   
Pfam
PF00078   RVT_1        + More
PF14529   Exo_endo_phos_2
Interpro
IPR036691   Endo/exonu/phosph_ase_sf        + More
IPR005135   Endo/exonuclease/phosphatase       
IPR000477   RT_dom       
SUPFAM
SSF56219   SSF56219       
Gene 3D

Ontologies

Topology

Length:
215
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
1.16018
Exp number, first 60 AAs:
0.00062
Total prob of N-in:
0.09419
outside
1  -  215
 
 

Population Genetic Test Statistics

Pi
2.775001
Theta
7.951037
Tajima's D
-1.990642
CLR
184.929872
CSRT
0.0116994150292485
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号