SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO12667  Validated by peptides from experiments
Pre Gene Modal
BGIBMGA001402
Annotation
mitochondrial_aldehyde_dehydrogenase_[Bombyx_mori]
Location in the cell
Cytoplasmic   Reliability : 1.277 Mitochondrial   Reliability : 1.767 Nuclear   Reliability : 1.15
 

Sequence

CDS
ATGTTCGGCATCAGAACACCAGTTAAAAAACCAAACGGCAGTGAGGACAAGTCTGAATTCGAAGGACAGCCAGGTCCGTCTGTAAGGCGCAGCATTGGTGATTGGCCCCCCATAGTCGAAAAAGAGCAGCAAAGGCCAAAAACACCATCTCCACCAAAAGCTGTGCCTCAGCCGCTCCCTCCTAGGCCTAAGACCAAAGCGTTGATCGCCCAGGAAGCAAAAGCTGACCCACGGAGACAGGCGGCAAGAGTCAGTGACAGCCCGCCAATTACAGTCCCGTCGAGATTTCCGAGCAAAACCGCAGAGGCTAAAGCGTGCCTTATGAAAAGCAAGGCGGAGCTCGAAATCTCCAAAAACCTAAAACGGGAGATAAAAGAAGAAGTCTTTAGGTCAATCGAACGGCTCTACCAGCTGGTGAAAGAAGCCGAAGGCGAAAAGGCTTCCCAAGCCACCAACAAGTGGCCGACAGAAGCCTGTAGCATGGTCACTCGGACTGGTAACGAGGGTGACATATCACCGGGCCCAGAAGCGCCGACAGAGCTCATGAAACAGCTAATAGGCGGCCTCAAACAGCACCACGTTGCGTTAGAGGAATGCAAACGGCATACTCGAGCTCTGTCGGAACAGCTGGAGAAAACCCCTCTCTGCGCCGCAGGACATGGGTCATTAGATGAACACAGCCAACTCTTAAAGGAAAACAAAGAAGAAATAGAAAAACTAAGTGAAGAAATAAAAAAGCAAAGGACAGAATGGAAAGAAAATAGGAGCTACGCAAGCGTTGTCAGTGGCACAAAGGAGAAAGAACGCGGAAATGCGGAGATGCATTCCGTCGTGATCTCCTCAGACGACCAGAATGCCACAGGGGAAGACGTATTTAATAAGATCAGGTCAACCCTCAACGCTAAAGAGGAAGGGATAAAAATAGACAGGATAAGAAAGGTGAAAGATAGAAAAGTTATAGTCGGCTGTGAATCGAAAGAAGAATTAGTAAAAATAAGAGAAACAATTAAAACAAAGGGAAAGGACTTACACCTCCAGGAGATAAGAAATAAGGAACCCATGGTACAATTGAAGGATGTCCTGAATTATAATAAGGATGAAGATATAGTGCGAGCACTAATTAACCAGAACAAACATCTTCTGGGGGATGTGAGTGTGGACAGCTCAACTCTGAAGGTAAAGTTCAGAAGAAGAGCTAGAAACCCGCTCACATCCCATGTGGCAATACAAGTGCCACCAAAACTATGGAAGCGGCTCACGGAGGCGGGGCTAGTCCATATAGATGTGCAAAGGGTCAGGGTAGAGGATCAGTCTCCCCTGATTCAGTGCTCGCGATGCTTGGGATATGGCCACGGGAAGCGGTTCTGCCGGGAAAAAATTGACGCCTGCAGTCACTGCGGAGAGGCGCATCATAGGTCGGAATGCGCTGACTGGATGGCGAGGGTGCCTCCGTCGTGCTGTAACTGCTTGAAGGCTAAAATCGGTGAAGCCGAGCATAATGCCTTTAGCCCAGAGTGTCCAGTAAGGAAGAGACTTGGATCACCATGGAGAACAATGGACGCCTCCGAGAGGGGGGCCCTTATCAACAAACTAGCAGATTTGATTGAAAGAGACAGAACCTATTTAGCTAGCCTGGAGACGCTGGACAACGGCAAACCATACAAGGACTCGTATTTCGGTGATCTGTATGCTTCAATAAAAAACCTACGGTACTACGCCGGGTGGGCCGACAAGATCCACGGGAATGTCCTGCCCGCCGACGGAAAATACTTTGCTTACACTCGTCATGAGCCAGTGGGTGTGTGCGGTCAGATAATACCATGGAACTTCCCTATATTGATGGCGGCTTGGAAGCTCGGGCCAGCTCTGGCGACGGGTTGTACTGTGGTCATGAAGCCGGCCGAGCAGACGCCGCTCACAGCTCTGTACATCGCTCAACTAGTCAAGGAAGCAGGTTTCCCACCCGGGGTCGTGAATATGTTGCCGGGCTACGGAGACACCGGGGCCGCCATCGTGGACCACCCCGACGTAGATAAAGTGGCCTTCACCGGTTCGACGGAGGTGGGCAAGCTAATCCAGCGCGGCGCGGCGTCGACGATAAAGCGCATCACGCTGGAGCTGGGCGGCAAGTCGCCCAACATCGTGCTGGCCGACACCGACCTGCCGCGCGCCGTGGAGGCCGCGCACAACGCGCTCTTCTACAACATGGGGCAGTGCTGCTGCGCCGGCTCTCGCACCTTCGTGGAGGACAAGATTTACGACCAGTTCGTAGAGTTGTCGGCCGAGCGCGCCAACCGCCGCGTGGTCGGGGACCCCTTCCGGCCGGACGTGGAGCAGGGACCCCAGATCGACAACGAGCAGCGCGACAAGATCCTGCAGCTGATCAGCTCCGGGTCGCGGCAGGGCGCGCGGCTGGCGGCGGGCGGCGGCGCGGCCCCCGGGCCCGGCTACTTCGTGCAGCCCACCGTCTTCTGTGACGTCACCGACGACATGGACATCGCTAAGACAGAGATCTTTGGGCCGGTGCAGCAAATCCTGAAGTTCTCCCAGTTCGACGAGGTGGTGGAGCGCGCCAACAACTCGGAGTACGGACTGGCCGCCGCTGTCTTCACTAAAGATCTAGACAAGGCCAACTACTTCGTACAGAGGCTGCGCGCCGGCACCATTTGGGTTAACGACTACAACGTATTCGGGAACCAAGTGCCCTTCGGCGGCTTCAAGCAGTCCGGGCTGGGCCGCGAGAACGGGCCCTACGGACTCCGCAACTACCTCGAGGTCAAGGCCGTCGTCGTCAAACTCGCCGACAAGAACACGTGA
Protein
MFGIRTPVKKPNGSEDKSEFEGQPGPSVRRSIGDWPPIVEKEQQRPKTPSPPKAVPQPLPPRPKTKALIAQEAKADPRRQAARVSDSPPITVPSRFPSKTAEAKACLMKSKAELEISKNLKREIKEEVFRSIERLYQLVKEAEGEKASQATNKWPTEACSMVTRTGNEGDISPGPEAPTELMKQLIGGLKQHHVALEECKRHTRALSEQLEKTPLCAAGHGSLDEHSQLLKENKEEIEKLSEEIKKQRTEWKENRSYASVVSGTKEKERGNAEMHSVVISSDDQNATGEDVFNKIRSTLNAKEEGIKIDRIRKVKDRKVIVGCESKEELVKIRETIKTKGKDLHLQEIRNKEPMVQLKDVLNYNKDEDIVRALINQNKHLLGDVSVDSSTLKVKFRRRARNPLTSHVAIQVPPKLWKRLTEAGLVHIDVQRVRVEDQSPLIQCSRCLGYGHGKRFCREKIDACSHCGEAHHRSECADWMARVPPSCCNCLKAKIGEAEHNAFSPECPVRKRLGSPWRTMDASERGALINKLADLIERDRTYLASLETLDNGKPYKDSYFGDLYASIKNLRYYAGWADKIHGNVLPADGKYFAYTRHEPVGVCGQIIPWNFPILMAAWKLGPALATGCTVVMKPAEQTPLTALYIAQLVKEAGFPPGVVNMLPGYGDTGAAIVDHPDVDKVAFTGSTEVGKLIQRGAASTIKRITLELGGKSPNIVLADTDLPRAVEAAHNALFYNMGQCCCAGSRTFVEDKIYDQFVELSAERANRRVVGDPFRPDVEQGPQIDNEQRDKILQLISSGSRQGARLAAGGGAAPGPGYFVQPTVFCDVTDDMDIAKTEIFGPVQQILKFSQFDEVVERANNSEYGLAAAVFTKDLDKANYFVQRLRAGTIWVNDYNVFGNQVPFGGFKQSGLGRENGPYGLRNYLEVKAVVVKLADKNT

Summary

Uniprot
ProteinModelPortal
PDB
4KWG     E-value=8.46138e-171,     Score=1545

Ontologies

Topology

Length:
938
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.0054
Exp number, first 60 AAs:
0
Total prob of N-in:
0.00003
outside
1  -  938
 
 

Population Genetic Test Statistics

Pi
12.787476
Theta
17.267288
Tajima's D
-1.537615
CLR
131.129992
CSRT
0.056197190140493
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Peptides ×
Source Sequence Identity Evalue
26280517 DVYIGAGAIAGAYCR 97.56 1e-22
28556443 DSYFGDLYASIK 100.00 1e-15
28556443 DSYFGDLYASIK 100.00 1e-15
26280517 EAFNMIDQNR 96.67 3e-15
25044914 EAFYIATIGGAK 96.67 3e-15
26280517 GVGTIVAPNKVEVHGEK 95.65 3e-12
26280517 IGDDNIGTIVIGIFGK 100.00 5e-11
25044914 AGTIFGIAIFSGTEECAAK 100.00 5e-11
28467696 AGTGIENIEDDFRNGIK 100.00 5e-11
28556443 HEPVGVCGQ 100.00 5e-11
28556443 YEALLAVQK 100.00 5e-11
26822097 FSQFDEVVER 95.45 1e-10
26280517 ASRDPATDQIINYKK 95.45 1e-10
28467696 AVDVFFPAEAQNDFPVAMQVSPK 95.45 1e-10
26280517 VVGDIAQFMVQNK 100.00 2e-09
26822097 TEIFGPVQQIIK 100.00 9e-09
26280517 QSIPPGIQVK 100.00 9e-09
28467696 RVVEYSANDATGFK 100.00 9e-09
28556443 LADLIER 100.00 2e-08
26822097 IADIIER 100.00 5e-08
26280517 VVDAIGNPIDGK 100.00 5e-08
25044914 VVGDKDAEDNWR 100.00 5e-08
28467696 VVGDIAQFMVQNK 100.00 5e-08
28556443 VVGDPFRPDVEQGPQIDNEQR 100.00 5e-08
28556443 VAFTGSTEVGK 100.00 5e-08
28556443 VAFTGSTEVGK 100.00 5e-08
26280517 IAAAEIQIENIK 100.00 5e-08
25044914 IAAFNDIVIAK 100.00 5e-08
28556443 IYDQFVELSAER 100.00 5e-08
28556443 TENPANGQVIAEVQHANK 100.00 1e-04
28556443 IYDQFVELSAER 100.00 3e-04
28556443 LAAGGGAAPGPGYFVQPTVFCDVTDDMDIAK 100.00 3e-04
28556443 ANNSEYGLAAAVFTK 100.00 0.002
28556443 AGTIWVNDYNVFGNQVPFGGFK 100.00 0.002
28556443 AGTIWVNDYNVFGNQVPFGGFK 100.00 0.002
28556443 MLPGYGDTGAAIVDHPDVDK 100.00 0.003
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号