SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO12631  Validated by peptides from experiments
Pre Gene Modal
BGIBMGA001415
Annotation
PREDICTED:_uncharacterized_protein_LOC103519968_isoform_X3_[Diaphorina_citri]
Full name
Polyubiquitin-A       + More
Polyubiquitin-C      
Polyubiquitin      
Location in the cell
Nuclear   Reliability : 1.911
 

Sequence

CDS
ATGCAGATTTTTGTAAAAACTCTCACTGGTAAAACCATAACATTAGAAGTCGAAGCATCCGACACCATAGAAAATGTAAAAGCAAAAATTCAAGACAAAGAGGGCATTCCTCCAGATCAGCAGCGACTGATTTTCGCTGGGAAACAACTTGAAGACGGACGGACATTATCCGATTACAATATTCAAAAAGAATCTACTCTCCATTTGGTATTACGTCTGAGAGGTGGAATGCAGATCTTTGTGAAAACACTTACCGGTAAAACCATCACACTAGAAGTTGAAGCATCTGACACCATTGAGAATGTGAAAGCCAAGATTCAGGACAAAGAGGGAATTCCCCCAGATCAGCAGCGATTGATCTTTGCGGGCAAACAGCTTGAAGATGGCCGTACATTATCTGACTACAACATCCAGAAAGAATCTACTCTGCATTTGGTGTTACGTCTCAGAGGTGGCATGCAGATCTTTGTGAAAACACTTACCGGTAAAACCATCACACTAGAAGTTGAAGCATCTGACACCATTGAGAATGTGAAAGCAAAGATTCAGGACAAAGAGGGAATTCCTCCGGATCAGCAGCGGTTGATCTTTGCGGGCAAACAGCTTGAAGATGGCCGTACACTATCCGACTACAACATCCAGAAAGAATCTACTCTGCACTTGGTTTTGAGACTGCGTGGTGGCATGCAGATCTTTGTGAAAACACTTACCGGTAAAACCATCACACTAGAAGTTGAAGCATCTGACACCATCGAAAATGTGAAAGCCAAGATTCAGGACAAAGAGGGAATTCCCCCAGATCAGCAGCGATTGATCTTTGCGGGCAAACAGCTTGAAGATGGTCGTACACTATCTGACTACAACATCCAGAAAGAATCTACTCTGCATTTGGTATTACGTCTCAGAGGTGGCATGCAGATCTTTGTGAAAACACTTACCGGTAAAACCATCACATTGGAAGTTGAAGCATCTGACACCATCGAAAATGTGAAAGCCAAGATTCAGGACAAAGAGGGAATTCCCCCAGATCAGCAGCGATTGATTTTTGCTGGCAAACAGCTTGAAGATGGTCGTACATTATCTGACTACAACATCCAGAAAGAATCTACTCTGCATTTGGTGTTACGTCTCAGAGGTGGCATGCAAATCTTTGTGAAAACACTTACCGGTAAAACCATCACACTAGAAGTTGAAGCATCTGACACCATTGAAAATGTGAAAGCAAAGATTCAGGACAAAGAGGGAATTCCCCCAGATCAGCAGCGATTGATTTTTGCGGGCAAACAGCTTGAAGATGGCCGTACATTATCTGACTACAACATCCAGAAAGAATCTACTCTGCATTTGGTGTTACGTCTCAGAGGTGGAATGCAGATTTTTGTGAAAACACTTACCGGTAAAACCATCACATTGGAAGTTGAAGCATCTGACACCATCGAAAATGTGAAAGCCAAGATTCAGGACAAAGAGGGAATTCCCCCAGATCAGCAGCGATTGATTTTTGCTGGCAAACAGCTTGAAGATGGTCGTACATTATCTGACTACAACATCCAGAAAGAATCTACTCTGCATTTGGTTTTGAGACTGCGTGGTGGCATGCAAATCTTTGTGAAAACACTTACCGGTAAAACCATCACACTAGAAGTTGAAGCATCTGACACCATAGAAAATGTGAAAGCCAAGATTCAGGACAAAGAGGGAATTCCCCCAGATCAGCAGCGATTGATTTTTGCGGGCAAACAGCTTGAAGATGGTCGTACATTATCTGACTACAACATCCAGAAAGAATCTACTCTGCATTTGGTGCTACGTCTCAGAGGTGGAATGCAGATTTTTGTGAAAACACTTACCGGTAAAACCATCACATTGGAAGTTGAAGCATCTGACACCATCGAAAATGTGAAAGCCAAGATTCAGGACAAAGAGGGAATTCCCCCAGATCAGCAGCGATTGATTTTTGCGGGCAAACAGCTTGAAGATGGTCGTACATTATCTGACTACAACATCCAGAAAGAATCTACTCTGCATTTGGTTTTGAGACTGCGTGGTGGCATGCAGATCTTTGTGAAAACACTTACCGGTAAAACCATCACACTAGAAGTTGAAGCATCTGACACCATTGAGAATGTGAAAGCCAAGATTCAGGATAAAGAGGGAATTCCCCCAGATCAGCAGCGATTGATCTTTGCGGGCAAACAGCTTGAAGATGGTCGTACACTATCTGACTACAACATCCAGAAAGAATCTACTCTGCATTTGGTATTACGTCTCAGAGGTGGCATGCAAATCTTTGTGAAAACACTTACCGGTAAAACCATCACGCTAGAAGTTGAAGCATCTGACACCATTGAGAATGTGAAAGCCAAGATTCAGGATAAAGAGGGAATTCCCCCAGATCAGCAGCGATTGATCTTTGCAGGCAAACAGCTTGAAGATGGTCGTACACTATCTGACTACAACATCCAGAAAGAATCTACTCTGCATTTGGTTTTGAGACTGCGTGGTGGCATGCAGATCTTTGTGAAAACACTTACCGGTAAAACCATCACACTAGAAGTTGAAGCATCTGACACCATTGAGAATGTGAAAGCCAAGATTCAGGATAAAGAGGGAATTCCCCCAGATCAGCAGCGATTGATCTTTGCAGGCAAACAGCTTGAAGATGGTCGTACACTATCTGACTACAACATCCAGAAAGAATCTACTCTGCATTTGGTGTTACGTCTCAGAGGTGGAATGCAGATTTTTGTGAAAACACTTACCGGTAAAACCATCACATTGGAAGTTGAAGCATCTGACACCATCGAAAATGTGAAAGCCAAAATTCAGGACAAAGAGGGAATTCCTCCGGATCAGCAGCGATTGATCTTTGCGGGGAAACAGCTTGAAGACGGCCGTACACTATCTGACTACAACATCCAGAAAGAATCTACTCTGCATTTGGTTTTGAGACTGCGTGGTGGCATGCAGATCTTTGTCAAAACACTTACCGGTAAAACCATCACATTGGAAGTTGAAGCATCTGACACCATCGAAAATGTGAAAGCCAAGATTCAGGACAAAGAGGGAATTCCTCCGGATCAGCAGCGATTGATCTTTGCGGGCAAACAGCTTGAAGATGGCCGTACACTATCTGACTACAACATCCAGAAAGAATCTACTTTACATTTGGTTTTGAGACTCCGTGGTGGCATGTAG
Protein
MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM

Summary

Description
Ubiquitin exists either covalently attached to another protein, or free (unanchored). When covalently bound, it is conjugated to target proteins via an isopeptide bond either as a monomer (monoubiquitin), a polymer linked via different Lys residues of the ubiquitin (polyubiquitin chains) or a linear polymer linked via the initiator Met of the ubiquitin (linear polyubiquitin chains). Polyubiquitin chains, when attached to a target protein, have different functions depending on the Lys residue of the ubiquitin that is linked: Lys-48-linked is involved in protein degradation via the proteasome. Linear polymer chains formed via attachment by the initiator Met lead to cell signaling. Ubiquitin is usually conjugated to Lys residues of target proteins, however, in rare cases, conjugation to Cys or Ser residues has been observed. When polyubiquitin is free (unanchored-polyubiquitin), it also has distinct roles, such as in activation of protein kinases, and in signaling (By similarity).
Ubiquitin: Exists either covalently attached to another protein, or free (unanchored). When covalently bound, it is conjugated to target proteins via an isopeptide bond either as a monomer (monoubiquitin), a polymer linked via different Lys residues of the ubiquitin (polyubiquitin chains) or a linear polymer linked via the initiator Met of the ubiquitin (linear polyubiquitin chains). Polyubiquitin chains, when attached to a target protein, have different functions depending on the Lys residue of the ubiquitin that is linked: Lys-6-linked may be involved in DNA repair; Lys-11-linked is involved in ERAD (endoplasmic reticulum-associated degradation) and in cell-cycle regulation; Lys-29-linked is involved in lysosomal degradation; Lys-33-linked is involved in kinase modification; Lys-48-linked is involved in protein degradation via the proteasome; Lys-63-linked is involved in endocytosis, DNA-damage responses as well as in signaling processes leading to activation of the transcription factor NF-kappa-B. Linear polymer chains formed via attachment by the initiator Met lead to cell signaling. Ubiquitin is usually conjugated to Lys residues of target proteins, however, in rare cases, conjugation to Cys or Ser residues has been observed. When polyubiquitin is free (unanchored-polyubiquitin), it also has distinct roles, such as in activation of protein kinases, and in signaling (By similarity).
Miscellaneous
In C.elegans ubiquitin is encoded by 2 different genes. ubq-2 gene codes for a single copy of ubiquitin fused to the ribosomal proteins L40. ubq-1 gene codes for a polyubiquitin precursor with exact head to tail repeats.
For the sake of clarity sequence features are annotated only for the first chain, and are not repeated for each of the following chains.
Ubiquitin is encoded by 4 different genes. Uba52 and Rps27a genes code for a single copy of ubiquitin fused to the ribosomal proteins L40 and S27a, respectively. UBB and UBC genes code for a polyubiquitin precursor with exact head to tail repeats, the number of repeats differ between species and strains.
In Drosophila ubiquitin is encoded by 3 different genes. RpL40 and RpS27A genes code for a single copy of ubiquitin fused to the ribosomal proteins L40 and S27a, respectively. Ubi-p63E gene codes for a polyubiquitin precursor with 10 exact head to tail repeats.
Ubiquitin is encoded by 4 different genes. UBA52 and RPS27A genes code for a single copy of ubiquitin fused to the ribosomal proteins L40 and S27a, respectively. UBB and UBC genes code for a polyubiquitin precursor with exact head to tail repeats, the number of repeats differ between species and strains.
Similarity
Belongs to the ubiquitin family.
Keywords
Complete proteome   Cytoplasm   Isopeptide bond   Nucleus   Reference proteome   Repeat   Ubl conjugation   3D-structure   ADP-ribosylation   Direct protein sequencing   Phosphoprotein  
Feature
chain  Ubiquitin
EMBL
AB209782    BAD93019.1    AY118702    AAM50562.1    JXUM01141442    KQ569246    + More
KXJ68707.1    AAAB01008987    EAL38503.3    DS231862    EDS39770.1    PRFC01000016    PWV17888.1    PRFC01000046    PWV12995.1    QSBY01000011    RHW67705.1    CADA01000041    CAM39530.1    UINB01000036    SUZ46748.1    CP029535    AYU83724.1    JYDN01000241    KRX52531.1    AB003732    BAA23488.1    QOIP01000006    RLU22134.1    KQ764626    OAD54467.1    CH933809    EDW17615.1    KRG05643.1    QCYY01003020    ROT65878.1    FR799010    CAM44128.1    PRFA01000275    PWU83895.1    HE575324    CCC95569.1    BABH01006376    AAZX01001755    GL379800    EGT35653.1    AB021974    BAA76676.1    DS268419    EFO86690.1    KQ414611    KOC69219.1    KRG05644.1    GEMB01002637    JAS00552.1    CH480817    EDW50378.1    AEMK02000096    PRFA01000138    PWU85926.1    FN595241    CCB47636.1    KV919117    OSX71664.1    AB003731    BAA23487.1    KK107128    EZA58281.1    M23433    FO081045    M21321    DS235850    EEB18688.1    LS997634    SYZ70200.1    CH954178    EDV50822.2    CM000159    KRK01102.1    QCYY01001188    ROT79785.1    CH902618    EDV39905.1    KPU78285.1    NBAG03000260    PNI57239.1    PNI57240.1    PNI57242.1    PNI57243.1    PNI57244.1    PNI57246.1    GBGD01000471    JAC88418.1    OIVN01001092    SPC89743.1    AMQM01007187    KB097579    ESN94006.1    CM001220    KEH31009.1    FR796432    CAJ09316.1    KZ772766    PTQ32829.1    JYDJ01000365    KRX36432.1    FR796441    CAM65917.2    D17296    BC103477    AC113658    HE601284    CAP28749.2    KQS43535.1    NWSH01000780    PCG74275.1    GDIQ01209048    JAK42677.1    AE014296    AAS64964.1    AGB94078.1    EDW93311.2    KRK01103.1    M33013    M33015    M33122    M22428    CH477284    EAT44779.1    KPU78284.1    GDIP01150781    GDIP01037838    JAM65877.1    AB089616    AB089614    GL732547    EFX80447.1    GDIP01196884    JAJ26518.1    GDIQ01028301    JAN66436.1    PWV17890.1    GDIP01194525    JAJ28877.1    GDIP01195771    JAJ27631.1    KN538398    KHJ43005.1    X98063    CAA66667.1    GFTR01007936    JAW08490.1    AEOI02000010    ESW96372.1    KL363245    KL367480    KFD50983.1    KFD71912.1    KZ305064    PIA31856.1    LJIJ01000159    ODN01335.1   
Pfam
PF00240   ubiquitin        + More
PF01020   Ribosomal_L40e
Interpro
IPR029071   Ubiquitin-like_domsf        + More
IPR019954   Ubiquitin_CS       
IPR019956   Ubiquitin       
IPR000626   Ubiquitin_dom       
IPR011332   Ribosomal_zn-bd       
IPR038587   L40e_sf       
IPR001975   Ribosomal_L40e       
SUPFAM
SSF54236   SSF54236        + More
SSF57829   SSF57829       
Gene 3D
PDB
5B83     E-value=1.31811e-145,     Score=1328

Ontologies

Topology

Subcellular location
Cytoplasm  
Nucleus  
Length:
1065
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00035
Exp number, first 60 AAs:
0
Total prob of N-in:
0.00001
outside
1  -  1065
 
 

Population Genetic Test Statistics

Pi
81.134893
Theta
164.876936
Tajima's D
-1.573771
CLR
5.300741
CSRT
0.0516974151292435
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Peptides ×
Source Sequence Identity Evalue
26280517 AKIEETTKMEPK 100.00 0.002
26280517 AKIEETTKMEPK 100.00 0.002
26280517 AKIEETTKMEPK 100.00 0.002
26280517 AKIEETTKMEPK 100.00 0.002
26280517 AKIEETTKMEPK 100.00 0.002
26280517 AKIEETTKMEPK 100.00 0.002
26280517 AKIEETTKMEPK 100.00 0.002
26280517 AKIEETTKMEPK 100.00 0.002
26280517 AKIEETTKMEPK 100.00 0.002
26280517 AKIEETTKMEPK 100.00 0.002
26280517 AKIEETTKMEPK 100.00 0.002
26280517 AKIEETTKMEPK 100.00 0.002
26280517 AKIEETTKMEPK 100.00 0.002
26280517 AKIEETTKMEPK 100.00 0.002
27102218 TITIEVEASDTIENVK 100.00 0.002
27102218 TITIEVEASDTIENVK 100.00 0.002
27102218 TITIEVEASDTIENVK 100.00 0.002
27102218 TITIEVEASDTIENVK 100.00 0.002
27102218 TITIEVEASDTIENVK 100.00 0.002
27102218 TITIEVEASDTIENVK 100.00 0.002
27102218 TITIEVEASDTIENVK 100.00 0.002
27102218 TITIEVEASDTIENVK 100.00 0.002
27102218 TITIEVEASDTIENVK 100.00 0.002
27102218 TITIEVEASDTIENVK 100.00 0.002
27102218 TITIEVEASDTIENVK 100.00 0.002
27102218 TITIEVEASDTIENVK 100.00 0.002
27102218 TITIEVEASDTIENVK 100.00 0.002
27102218 TITIEVEASDTIENVK 100.00 0.002
28467696 AKIETNFNTIQTK 100.00 0.002
28467696 AKIETNFNTIQTK 100.00 0.002
28467696 AKIETNFNTIQTK 100.00 0.002
28467696 AKIETNFNTIQTK 100.00 0.002
28467696 AKIETNFNTIQTK 100.00 0.002
28467696 AKIETNFNTIQTK 100.00 0.002
28467696 AKIETNFNTIQTK 100.00 0.002
28467696 AKIETNFNTIQTK 100.00 0.002
28467696 AKIETNFNTIQTK 100.00 0.002
28467696 AKIETNFNTIQTK 100.00 0.002
28467696 AKIETNFNTIQTK 100.00 0.002
28467696 AKIETNFNTIQTK 100.00 0.002
28467696 AKIETNFNTIQTK 100.00 0.002
28467696 AKIETNFNTIQTK 100.00 0.002
28556443 TITLEVEASDTIENVK 100.00 0.005
28556443 TITLEVEASDTIENVK 100.00 0.005
28556443 TITLEVEASDTIENVK 100.00 0.005
28556443 TITLEVEASDTIENVK 100.00 0.005
28556443 TITLEVEASDTIENVK 100.00 0.005
28556443 TITLEVEASDTIENVK 100.00 0.005
28556443 TITLEVEASDTIENVK 100.00 0.005
28556443 TITLEVEASDTIENVK 100.00 0.005
28556443 TITLEVEASDTIENVK 100.00 0.005
28556443 TITLEVEASDTIENVK 100.00 0.005
28556443 TITLEVEASDTIENVK 100.00 0.005
28556443 TITLEVEASDTIENVK 100.00 0.005
28556443 TITLEVEASDTIENVK 100.00 0.005
28556443 TITLEVEASDTIENVK 100.00 0.005
28556443 MQIFVK 100.00 0.005
28556443 MQIFVK 100.00 0.005
28556443 MQIFVK 100.00 0.005
28556443 MQIFVK 100.00 0.005
28556443 MQIFVK 100.00 0.005
28556443 MQIFVK 100.00 0.005
28556443 MQIFVK 100.00 0.005
28556443 MQIFVK 100.00 0.005
28556443 MQIFVK 100.00 0.005
28556443 MQIFVK 100.00 0.005
28556443 MQIFVK 100.00 0.005
28556443 MQIFVK 100.00 0.005
28556443 MQIFVK 100.00 0.005
28556443 MQIFVK 100.00 0.005
28556443 ESTLHLVLR 100.00 0.005
28556443 ESTLHLVLR 100.00 0.005
28556443 ESTLHLVLR 100.00 0.005
28556443 ESTLHLVLR 100.00 0.005
28556443 ESTLHLVLR 100.00 0.005
28556443 ESTLHLVLR 100.00 0.005
28556443 ESTLHLVLR 100.00 0.005
28556443 ESTLHLVLR 100.00 0.005
28556443 ESTLHLVLR 100.00 0.005
28556443 ESTLHLVLR 100.00 0.005
28556443 ESTLHLVLR 100.00 0.005
28556443 ESTLHLVLR 100.00 0.005
28556443 ESTLHLVLR 100.00 0.005
28556443 ESTLHLVLR 100.00 0.005
26822097 VPEHMDIVK 100.00 0.034
26822097 VPEHMDIVK 100.00 0.034
26822097 VPEHMDIVK 100.00 0.034
26822097 VPEHMDIVK 100.00 0.034
26822097 VPEHMDIVK 100.00 0.034
26822097 VPEHMDIVK 100.00 0.034
26822097 VPEHMDIVK 100.00 0.034
26822097 VPEHMDIVK 100.00 0.034
26822097 VPEHMDIVK 100.00 0.034
26822097 VPEHMDIVK 100.00 0.034
26822097 VPEHMDIVK 100.00 0.034
26822097 VPEHMDIVK 100.00 0.034
26822097 VPEHMDIVK 100.00 0.034
26822097 VPEHMDIVK 100.00 0.034
26280517 IIDFVYIFK 100.00 0.034
26280517 IIDFVYIFK 100.00 0.034
26280517 IIDFVYIFK 100.00 0.034
26280517 IIDFVYIFK 100.00 0.034
26280517 IIDFVYIFK 100.00 0.034
26280517 IIDFVYIFK 100.00 0.034
26280517 IIDFVYIFK 100.00 0.034
26280517 IIDFVYIFK 100.00 0.034
26280517 IIDFVYIFK 100.00 0.034
26280517 IIDFVYIFK 100.00 0.034
26280517 IIDFVYIFK 100.00 0.034
26280517 IIDFVYIFK 100.00 0.034
26280517 IIDFVYIFK 100.00 0.034
26280517 IIDFVYIFK 100.00 0.034
25044914 IQDIIDGFIR 100.00 0.034
25044914 IQDIIDGFIR 100.00 0.034
25044914 IQDIIDGFIR 100.00 0.034
25044914 IQDIIDGFIR 100.00 0.034
25044914 IQDIIDGFIR 100.00 0.034
25044914 IQDIIDGFIR 100.00 0.034
25044914 IQDIIDGFIR 100.00 0.034
25044914 IQDIIDGFIR 100.00 0.034
25044914 IQDIIDGFIR 100.00 0.034
25044914 IQDIIDGFIR 100.00 0.034
25044914 IQDIIDGFIR 100.00 0.034
25044914 IQDIIDGFIR 100.00 0.034
25044914 IQDIIDGFIR 100.00 0.034
25044914 IQDIIDGFIR 100.00 0.034
27102218 MQIFVK 100.00 0.034
27102218 MQIFVK 100.00 0.034
27102218 MQIFVK 100.00 0.034
27102218 MQIFVK 100.00 0.034
27102218 MQIFVK 100.00 0.034
27102218 MQIFVK 100.00 0.034
27102218 MQIFVK 100.00 0.034
27102218 MQIFVK 100.00 0.034
27102218 MQIFVK 100.00 0.034
27102218 MQIFVK 100.00 0.034
27102218 MQIFVK 100.00 0.034
27102218 MQIFVK 100.00 0.034
27102218 MQIFVK 100.00 0.034
27102218 MQIFVK 100.00 0.034
28467696 IQDIIDGFIR 100.00 0.034
28467696 IQDIIDGFIR 100.00 0.034
28467696 IQDIIDGFIR 100.00 0.034
28467696 IQDIIDGFIR 100.00 0.034
28467696 IQDIIDGFIR 100.00 0.034
28467696 IQDIIDGFIR 100.00 0.034
28467696 IQDIIDGFIR 100.00 0.034
28467696 IQDIIDGFIR 100.00 0.034
28467696 IQDIIDGFIR 100.00 0.034
28467696 IQDIIDGFIR 100.00 0.034
28467696 IQDIIDGFIR 100.00 0.034
28467696 IQDIIDGFIR 100.00 0.034
28467696 IQDIIDGFIR 100.00 0.034
28467696 IQDIIDGFIR 100.00 0.034
29197581 EGIPPDQQR 100.00 0.034
29197581 EGIPPDQQR 100.00 0.034
29197581 EGIPPDQQR 100.00 0.034
29197581 EGIPPDQQR 100.00 0.034
29197581 EGIPPDQQR 100.00 0.034
29197581 EGIPPDQQR 100.00 0.034
29197581 EGIPPDQQR 100.00 0.034
29197581 EGIPPDQQR 100.00 0.034
29197581 EGIPPDQQR 100.00 0.034
29197581 EGIPPDQQR 100.00 0.034
29197581 EGIPPDQQR 100.00 0.034
29197581 EGIPPDQQR 100.00 0.034
29197581 EGIPPDQQR 100.00 0.034
29197581 EGIPPDQQR 100.00 0.034
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号