SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO12607  Validated by peptides from experiments
Pre Gene Modal
BGIBMGA001415
Annotation
PREDICTED:_uncharacterized_protein_LOC103519968_isoform_X3_[Diaphorina_citri]
Location in the cell
Nuclear   Reliability : 1.831
 

Sequence

CDS
ATGCAAATCTTTGTGAAGACTCTAACTGGCAAGACCATTACATTAGAAGTGGAGCCTTCTGACACAATTGAGAATGTGAAGGCGAAGATCCAAGACAAAGAAGGAATTCCTCCTGATCAACAGCGTCTCATCTTTGCTGGCAAGCAGCTGGAAGACGGACGCACCTTGTCAGACTACAACATTCAAAAAGAATCCACACTCCATCTTGTACTGCGTCTTCGTGGAGGCATGCAGATCTTCGTGAAAACTCTGACCGGAAAGACCATCACTTTGGAAGTAGAAGCTTCGGACACAATTGAGAATGTGAAGGCGAAGATCCAAGACAAAGAAGGAATTCCTCCTGATCAACAGCGTCTCATCTTTGCTGGCAAGCAGCTGGAAGACGGACGCACCTTGTCAGACTACAACATTCAAAAAGAATCCACACTCCATCTTGTACTGCGTCTTCGTGGAGGCATGCAGATCTTCGTGAAAACTCTGACCGGAAAGACCATCACTTTGGAAGTAGAAGCTTCGGACACAATTGAGAATGTGAAGGCGAAGATCCAAGACAAAGAAGGAATTCCTCCTGATCAACAGCGTCTCATCTTTGCTGGCAAGCAGCTGGAAGACGGACGCACCTTGTCAGACTACAACATTCAAAAAGAATCCACTCTCCATCTTGTACTGCGTCTTCGTGGAGGCATGCAGATCTTCGTGAAAACTCTGACCGGAAAGACCATCACTTTGGAAGTAGAAGCTTCGGACACAATTGAGAATGTGAAGGCGAAGATCCAAGACAAAGAAGGAATTCCTCCTGATCAACAGCGTCTCATCTTTGCTGGCAAGCAGCTGGAAGACGGACGCACCTTGTCAGACTACAACATTCAAAAAGAATCCACACTCCATCTTGTACTGCGTCTTCGTGGAGGCATGCAGATCTTCGTGAAAACTCTGACCGGAAAGACCATCACTTTGGAAGTAGAAGCATCCGACACAATTGAGAACGTGAAGGCGAAGATCCAAGACAAAGAAGGAATTCCTCCTGATCAACAGCGTCTCATCTTTGCTGGCAAGCAGCTGGAAGACGGACGCACCTTGTCAGACTACAACATTCAAAAAGAATCCACACTCCATCTTGTACTGCGTCTTCGTGGAGGCATGCAGATCTTCGTGAAAACTCTGACCGGAAAGACCATCACTTTGGAAGTAGAAGCTTCGGACACAATTGAGAATGTGAAGGCGAAGATCCAAGACAAAGAAGGAATTCCTCCTGATCAACAGCGTCTCATCTTTGCTGGCAAGCAGCTGGAAGACGGACGCACCTTGTCAGACTACAACATTCAAAAAGAATCCACACTCCATCTTGTACTGCGTCTTCGTGGAGGCATGCAGATCTTCGTAAAAACTCTGACCGGAAAGACCATCACTTTGGAAGTAGAAGCATCCGACACAATTGAGAATGTGAAGGCGAAGATCCAAGACAAAGAAGGAATTCCTCCTGATCAACAGCGTCTCATCTTTGCTGGCAAGCAGCTGGAAGACGGACGCACCTTGTCAGACTACAACATTCAAAAAGAATCCACACTCCATCTTGTACTGCGTCTTCGTGGAGGCATGCAGATCTTCGTGAAAACTCTGACTGGAAAGACCATCACTTTGGAAGTAGAAGCTTCGGACACAATCGAGAATGTGAAGGCGAAGATCCAAGACAAAGAAGGAATTCCTCCTGATCAACAGCGTCTCATCTTTGCTGGCAAGCAGCTGGAAGACGGACGCACCTTGTCAGACTACAACATTCAAAAGGAATCTACACTCCATTTAGTGTTACGTCTACGAGGAGGAATGCAGATCTTCGTAAAAACTCTGACCGGTAAGACCATCACTTTGGAAGTAGAAGCTTCGGACACAATCGAGAATGTGAAGGCGAAGATCCAAGACAAAGAAGGAATTCCTCCTGATCAACAGCGTCTCATCTTTGCTGGCAAGCAGCTGGAAGACGGACGCACCTTGTCAGACTACAACATTCAAAAAGAATCCACTCTCCATCTTGTACTGCGTCTTCGTGGAGGCATGCAGATCTTCGTGAAAACTCTGACCGGAAAGACCATCACTTTGGAAGTAGAAGCTTCGGACACAATTGAGAATGTGAAGGCGAAGATCCAAGACAAAGAAGGAATTCCTCCTGATCAACAGCGTCTCATCTTCGCTGGCAAGCAGCTGGAAGACGGACGCACCTTGTCAGACTACAACATTCAAAAAGAATCCACTCTCCATCTTGTACTGCGTCTTCGTGGAGGCATGCAGATCTTCGTGAAAACTCTGACCGGAAAGACCATCACTTTGGAAGTAGAAGCTTCGGACACAATTGAGAATGTGAAGGCGAAGATCCAAGACAAAGAAGGAATTCCTCCTGATCAACAGCGTCTCATCTTTGCTGGCAAGCAGCTGGAAGACGGACGCACCTTGTCAGACTACAACATTCAAAAAGAATCCACACTCCATCTTGTATTGCGTCTTCGTGGAGGCATGCAGATCTTCGTAAAAACTCTGACCGGTAAGACCATCACTTTGGAAGTAGAAGCTTCGGACACAATCGAGAATGTGAAGGCGAAGATCCAAGACAAAGAAGGAATTCCTCCTGATCAACAGCGTCTCATCTTTGCTGGCAAGCAGCTGGAAGACGGACGCACCTTGTCAGACTACAACATTCAAAAAGAATCCACACTCCATCTTGTACTGCGTCTTCGTGGAGGCATGCAGATCTTCGTGAAAACTCTGACCGGAAAGACCATCACTTTGGAAGTAGAAGCATCCGACACAATTGAGAACGTGAAGGCGAAGATCCAAGACAAAGAAGGAATTCCTCCTGATCAACAGCGTCTCATCTTTGCTGGCAAGCAGCTGGAAGACGGACGCACCTTGTCAGACTACAACATTCAAAAAGAATCCACACTCCATCTTGTACTGCGTCTTCGTGGAGGCATGCAGATCTTCGTGAAAACTCTGACCGGAAAGACCATCACTTTGGAAGTAGAAGCTTCGGACACAATTGAGAATGTGAAGGCGAAGATCCAAGACAAAGAAGGAATTCCTCCTGATCAACAGCGTCTCATCTTTGCTGGCAAGCAGCTGGAAGACGGACGCACCTTGTCAGACTACAACATTCAAAAAGAATCCACACTCCATCTTGTATTGCGTCTTCGTGGAGGCATGCAGATCTTCGTAAAAACTCTGACCGGTAAGACCATCACTTTGGAAGTAGAAGCTTCGGACACAATCGAGAATGTGAAGGCGAAGATCCAAGACAAAGAAGGAATTCCTCCTGATCAACAGCGTCTCATCTTTGCTGGCAAGCAGCTGGAAGACGGACGCACCTTGTCAGACTACAACATTCAAAAAGAATCCACACTCCATCTTGTACTGCGTCTTCGTGGAGGCATGCAGATCTTCGTGAAAACTCTGACCGGAAAGACCATCACTTTGGAAGTAGAAGCATCCGACACAATTGAGAACGTGAAGGCGAAGATCCAAGACAAAGAAGGAATTCCTCCTGATCAACAGCGTCTCATCTTTGCTGGCAAGCAGCTGGAAGACGGACGCACCTTGTCAGACTACAACATTCAAAAAGAATCCACACTCCATCTTGTACTGCGTCTTCGTGGAGGCATGCAGATCTTCGTGAAAACTCTGACCGGAAAGACCATCACTTTGGAAGTAGAAGCTTCGGACACAATTGAGAATGTGAAGGCGAAGATCCAAGACAAAGAAGGAATTCCTCCTGATCAACAGCGTCTCATCTTTGCTGGCAAGCAGCTGGAAGACGGACGCACCTTGTCAGACTACAACATTCAAAAAGAATCCACACTCCATCTTGTATTGCGTCTTCGTGGAGGCATGCAGATCTTCGTAAAAACTCTGACCGGTAAGACCATCACTTTGGAAGTAGAAGCTTCGGACACAATCGAGAATGTGAAGGCGAAGATCCAAGACAAAGAAGGAATTCCTCCTGATCAACAGCGTCTCATCTTTGCTGGCAAGCAGCTGGAAGACGGACGCACCTTGTCAGACTACAACATTCAAAAAGAATCCACACTCCATCTTGTACTGCGTCTTCGTGGAGGCATGCAGATCTTCGTGAAAACTCTGACCGGAAAGACCATCACTTTGGAAGTAGAAGCATCCGACACAATTGAGAACGTGAAGGCGAAGATCCAAGACAAAGAAGGAATTCCTCCTGATCAACAGCGTCTCATCTTTGCTGGCAAGCAGCTGGAAGACGGACGCACCTTGTCAGACTACAACATTCAAAAAGAATCCACACTCCATCTTGTATTGCGTCTTCGTGGAGGCATGCAGATCTTCGTAAAAACTCTGACCGGTAAGACCATCACTTTGGAAGTAGAAGCTTCGGACACAATCGAGAATGTGAAGGCGAAGATCCAAGACAAAGAAGGAATTCCTCCTGATCAACAGCGTCTCATCTTTGCTGGCAAGCAGCTGGAAGACGGACGCACCTTGTCAGACTACAACATTCAAAAAGAATCCACACTCCATCTTGTACTGCGTCTTCGTGGAGGCATGCAGATCTTCGTGAAAACTCTGACCGGTAAGACCATCACTTTGGAAGTAGAAGCTTCGGACACAATCGAGAATGTGAAGGCGAAGATCCAAGACAAAGAAGGAATTCCTCCTGATCAACAGCGTCTCATCTTTGCTGGCAAGCAGCTGGAAGACGGACGCACCTTGTCAGACTACAATATTCAAAAGGAATCTACACTCCATTTAGTGTTACGTCTACGAGGAGGAATGTAA
Protein
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM

Summary

Pfam
PF00240   ubiquitin        + More
PF01020   Ribosomal_L40e
Interpro
IPR029071   Ubiquitin-like_domsf        + More
IPR019954   Ubiquitin_CS       
IPR019956   Ubiquitin       
IPR000626   Ubiquitin_dom       
IPR011332   Ribosomal_zn-bd       
IPR038587   L40e_sf       
IPR001975   Ribosomal_L40e       
SUPFAM
SSF54236   SSF54236        + More
SSF57829   SSF57829       
Gene 3D
PDB
5B83     E-value=3.31199e-146,     Score=1335

Ontologies

Topology

Length:
1597
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00035
Exp number, first 60 AAs:
0
Total prob of N-in:
0.00001
outside
1  -  1597
 
 

Population Genetic Test Statistics

Pi
287.939293
Theta
180.249397
Tajima's D
2.471768
CLR
0.36784
CSRT
0.942002899855007
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Peptides ×
Source Sequence Identity Evalue
26280517 AKIEETTKMEPK 100.00 0.002
26280517 AKIEETTKMEPK 100.00 0.002
26280517 AKIEETTKMEPK 100.00 0.002
26280517 AKIEETTKMEPK 100.00 0.002
26280517 AKIEETTKMEPK 100.00 0.002
26280517 AKIEETTKMEPK 100.00 0.002
26280517 AKIEETTKMEPK 100.00 0.002
26280517 AKIEETTKMEPK 100.00 0.002
26280517 AKIEETTKMEPK 100.00 0.002
26280517 AKIEETTKMEPK 100.00 0.002
26280517 AKIEETTKMEPK 100.00 0.002
26280517 AKIEETTKMEPK 100.00 0.002
26280517 AKIEETTKMEPK 100.00 0.002
26280517 AKIEETTKMEPK 100.00 0.002
26280517 AKIEETTKMEPK 100.00 0.002
26280517 AKIEETTKMEPK 100.00 0.002
26280517 AKIEETTKMEPK 100.00 0.002
26280517 AKIEETTKMEPK 100.00 0.002
26280517 AKIEETTKMEPK 100.00 0.002
26280517 AKIEETTKMEPK 100.00 0.002
26280517 AKIEETTKMEPK 100.00 0.002
27102218 TITIEVEASDTIENVK 100.00 0.002
27102218 TITIEVEASDTIENVK 100.00 0.002
27102218 TITIEVEASDTIENVK 100.00 0.002
27102218 TITIEVEASDTIENVK 100.00 0.002
27102218 TITIEVEASDTIENVK 100.00 0.002
27102218 TITIEVEASDTIENVK 100.00 0.002
27102218 TITIEVEASDTIENVK 100.00 0.002
27102218 TITIEVEASDTIENVK 100.00 0.002
27102218 TITIEVEASDTIENVK 100.00 0.002
27102218 TITIEVEASDTIENVK 100.00 0.002
27102218 TITIEVEASDTIENVK 100.00 0.002
27102218 TITIEVEASDTIENVK 100.00 0.002
27102218 TITIEVEASDTIENVK 100.00 0.002
27102218 TITIEVEASDTIENVK 100.00 0.002
27102218 TITIEVEASDTIENVK 100.00 0.002
27102218 TITIEVEASDTIENVK 100.00 0.002
27102218 TITIEVEASDTIENVK 100.00 0.002
27102218 TITIEVEASDTIENVK 100.00 0.002
27102218 TITIEVEASDTIENVK 100.00 0.002
27102218 TITIEVEASDTIENVK 100.00 0.002
27102218 TITIEVEASDTIENVK 100.00 0.002
28467696 AKIETNFNTIQTK 100.00 0.002
28467696 AKIETNFNTIQTK 100.00 0.002
28467696 AKIETNFNTIQTK 100.00 0.002
28467696 AKIETNFNTIQTK 100.00 0.002
28467696 AKIETNFNTIQTK 100.00 0.002
28467696 AKIETNFNTIQTK 100.00 0.002
28467696 AKIETNFNTIQTK 100.00 0.002
28467696 AKIETNFNTIQTK 100.00 0.002
28467696 AKIETNFNTIQTK 100.00 0.002
28467696 AKIETNFNTIQTK 100.00 0.002
28467696 AKIETNFNTIQTK 100.00 0.002
28467696 AKIETNFNTIQTK 100.00 0.002
28467696 AKIETNFNTIQTK 100.00 0.002
28467696 AKIETNFNTIQTK 100.00 0.002
28467696 AKIETNFNTIQTK 100.00 0.002
28467696 AKIETNFNTIQTK 100.00 0.002
28467696 AKIETNFNTIQTK 100.00 0.002
28467696 AKIETNFNTIQTK 100.00 0.002
28467696 AKIETNFNTIQTK 100.00 0.002
28467696 AKIETNFNTIQTK 100.00 0.002
28467696 AKIETNFNTIQTK 100.00 0.002
28556443 NEMIAAITNR 100.00 0.003
28556443 TITLEVEASDTIENVK 100.00 0.007
28556443 TITLEVEASDTIENVK 100.00 0.007
28556443 TITLEVEASDTIENVK 100.00 0.007
28556443 TITLEVEASDTIENVK 100.00 0.007
28556443 TITLEVEASDTIENVK 100.00 0.007
28556443 TITLEVEASDTIENVK 100.00 0.007
28556443 TITLEVEASDTIENVK 100.00 0.007
28556443 TITLEVEASDTIENVK 100.00 0.007
28556443 TITLEVEASDTIENVK 100.00 0.007
28556443 TITLEVEASDTIENVK 100.00 0.007
28556443 TITLEVEASDTIENVK 100.00 0.007
28556443 TITLEVEASDTIENVK 100.00 0.007
28556443 TITLEVEASDTIENVK 100.00 0.007
28556443 TITLEVEASDTIENVK 100.00 0.007
28556443 TITLEVEASDTIENVK 100.00 0.007
28556443 TITLEVEASDTIENVK 100.00 0.007
28556443 TITLEVEASDTIENVK 100.00 0.007
28556443 TITLEVEASDTIENVK 100.00 0.007
28556443 TITLEVEASDTIENVK 100.00 0.007
28556443 TITLEVEASDTIENVK 100.00 0.007
28556443 MQIFVK 100.00 0.007
28556443 MQIFVK 100.00 0.007
28556443 MQIFVK 100.00 0.007
28556443 MQIFVK 100.00 0.007
28556443 MQIFVK 100.00 0.007
28556443 MQIFVK 100.00 0.007
28556443 MQIFVK 100.00 0.007
28556443 MQIFVK 100.00 0.007
28556443 MQIFVK 100.00 0.007
28556443 MQIFVK 100.00 0.007
28556443 MQIFVK 100.00 0.007
28556443 MQIFVK 100.00 0.007
28556443 MQIFVK 100.00 0.007
28556443 MQIFVK 100.00 0.007
28556443 MQIFVK 100.00 0.007
28556443 MQIFVK 100.00 0.007
28556443 MQIFVK 100.00 0.007
28556443 MQIFVK 100.00 0.007
28556443 MQIFVK 100.00 0.007
28556443 MQIFVK 100.00 0.007
28556443 ESTLHLVLR 100.00 0.007
28556443 ESTLHLVLR 100.00 0.007
28556443 ESTLHLVLR 100.00 0.007
28556443 ESTLHLVLR 100.00 0.007
28556443 ESTLHLVLR 100.00 0.007
28556443 ESTLHLVLR 100.00 0.007
28556443 ESTLHLVLR 100.00 0.007
28556443 ESTLHLVLR 100.00 0.007
28556443 ESTLHLVLR 100.00 0.007
28556443 ESTLHLVLR 100.00 0.007
28556443 ESTLHLVLR 100.00 0.007
28556443 ESTLHLVLR 100.00 0.007
28556443 ESTLHLVLR 100.00 0.007
28556443 ESTLHLVLR 100.00 0.007
28556443 ESTLHLVLR 100.00 0.007
28556443 ESTLHLVLR 100.00 0.007
28556443 ESTLHLVLR 100.00 0.007
28556443 ESTLHLVLR 100.00 0.007
28556443 ESTLHLVLR 100.00 0.007
28556443 ESTLHLVLR 100.00 0.007
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号