SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO12529
Pre Gene Modal
BGIBMGA013783
Annotation
AF461149_1_transposase_[Bombyx_mori]
Location in the cell
Nuclear   Reliability : 2.038
 

Sequence

CDS
ATGGAGTGGACGCTTAAAGAAGACCGTGTTGCAGTTATTGCGTTGCATCGTTGCGGTTACGCGCCAATTCAAATTTTTAACATACTGAAAATTTTGAATATAACGAAAAGATTCGTTTATCGTACCATCAAACGATACAATGAAGACTCTAGTGTAGATGACAGGTCAAGAAGTGGTCGCCCTCGGTCTGTTAGGACTCCAGCAGTGATAAAAGCTGTGAAGGCGCGAATTCAAAGAAATCCCAAACAAGAGAGCTACAACAAACAAAATGAAAAGGTGTACGCACACAGTAGTGAAGAAGCGAGCAACCGTATTCCGCGTGTCCAACGAGGTCATTTTCCATCCTCGCTCATGGTATGGTTGGGAGTTTCTTATTGGGGCTTAACAGAGGTACATTTTTGTGAGAAAGATGTAAAAACGAATGCAGTTGTGTATCAAAATACAGTCCTGACGAACCTTGTGGAACCTGTTTCTCATACTATGTTCAATAACAAGCACTGGGTATTCCAACAAGATTCGGCGTCAGCTCATAGAGCGAAGAGCACACAAGACTGGCTGGCGGCGCGTGAAATCGACTTCATCCGGCACGAAGACTGGCCCTCCTCCAGTCCAGATTTGAATCCGTTAGATTACAAGATATGGCAACACTTGGAGGAAAAGGCGTGCTCAAAGCCTCATCCCAATTTGGAGTCACTCAAGACATCCTTGATTAAGGCAGCCGCCGATATTGACATGGACCTCGTTCGTGCTGCGATAGACGACTGGCCGCGCAGATTGAAGGCCTGTATTCAAAATCACGGAGGTCATTTTGAATAA
Protein
MEWTLKEDRVAVIALHRCGYAPIQIFNILKILNITKRFVYRTIKRYNEDSSVDDRSRSGRPRSVRTPAVIKAVKARIQRNPKQESYNKQNEKVYAHSSEEASNRIPRVQRGHFPSSLMVWLGVSYWGLTEVHFCEKDVKTNAVVYQNTVLTNLVEPVSHTMFNNKHWVFQQDSASAHRAKSTQDWLAAREIDFIRHEDWPSSSPDLNPLDYKIWQHLEEKACSKPHPNLESLKTSLIKAAADIDMDLVRAAIDDWPRRLKACIQNHGGHFE

Summary

Similarity
Belongs to the TGF-beta family.
Belongs to the UDP-glycosyltransferase family.
Pfam
PF00019   TGF_beta        + More
PF07992   Pyr_redox_2
PF00201   UDPGT
PF13358   DDE_3
PF00292   PAX
Interpro
IPR001839   TGF-b_C        + More
IPR029034   Cystine-knot_cytokine       
IPR017948   TGFb_CS       
IPR015615   TGF-beta-rel       
IPR009057   Homeobox-like_sf       
IPR036188   FAD/NAD-bd_sf       
IPR023753   FAD/NAD-binding_dom       
IPR002213   UDP_glucos_trans       
IPR035595   UDP_glycos_trans_CS       
IPR036388   WH-like_DNA-bd_sf       
IPR038717   Tc1-like_DDE_dom       
IPR001523   Paired_dom       
SUPFAM
SSF57501   SSF57501        + More
SSF46689   SSF46689       
SSF51905   SSF51905       
Gene 3D
PDB
5CR4     E-value=3.71189e-09,     Score=145

Ontologies

Topology

Subcellular location
Secreted  
Length:
271
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
5.05605
Exp number, first 60 AAs:
4.71572
Total prob of N-in:
0.16769
outside
1  -  271
 
 

Population Genetic Test Statistics

Pi
46.521052
Theta
23.682708
Tajima's D
2.586061
CLR
19.945175
CSRT
0.953702314884256
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号