SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO12487
Annotation
AF461149_1_transposase_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 1.428 Nuclear   Reliability : 1.998
 

Sequence

CDS
ATGGAGTGGACGCTTAAAGAAGACCGTGTTGCAGTTATTGCGTTGCATCGTTGCGGTTACGCGCCAATTCAAATTTTTTACATACTGAAAAATTTGGATATAACCAAAAGATTCATTTATTGTACCATCAAACGATGCAATGAAGACTCTAGTGTAGATGACAGGTCAAGAAATGGTCGCCCTCGGTCTTTTAGGACTCCAGCAGTGATAAAAGCTGTGAAGGCGCGAATTCAAAGAAATCCCAAACATTCGGCGCCAGCTCATAGAGCGAAGAGCACACAAGACTGGCTGGCGGCGCGTGAAATCGACTTCATCCGACACGAAGACTGGCCCTCCTCCAGTCCAGATTTGAATCCGTTAGATTACAAGATATGGCAACACTTGGAGGAAAAGGCGTGCTCAAAGCCTCATCCCAATTTGGAGTCACTCAACACATCTTTGATTAAGGCAGCCGCCGATCTTGACATGGACCTCGTTCGTGCTGCGATAGACGACTGGCCGCGCAGATTGAAGGCCTGTATTCAAAATCACGGAGGTCATTTTGAATAA
Protein
MEWTLKEDRVAVIALHRCGYAPIQIFYILKNLDITKRFIYCTIKRCNEDSSVDDRSRNGRPRSFRTPAVIKAVKARIQRNPKHSAPAHRAKSTQDWLAAREIDFIRHEDWPSSSPDLNPLDYKIWQHLEEKACSKPHPNLESLNTSLIKAAADLDMDLVRAAIDDWPRRLKACIQNHGGHFE

Summary

Similarity
Belongs to the UDP-glycosyltransferase family.
Pfam
PF00201   UDPGT        + More
PF13358   DDE_3
Interpro
IPR009057   Homeobox-like_sf        + More
IPR002213   UDP_glucos_trans       
IPR035595   UDP_glycos_trans_CS       
IPR038717   Tc1-like_DDE_dom       
IPR036388   WH-like_DNA-bd_sf       
SUPFAM
SSF46689   SSF46689       
Gene 3D
PDB
5CR4     E-value=0.000140103,     Score=103

Ontologies

Topology

Length:
182
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
4.27251
Exp number, first 60 AAs:
4.27251
Total prob of N-in:
0.19209
outside
1  -  182
 
 

Population Genetic Test Statistics

Pi
18.370538
Theta
46.471102
Tajima's D
-0.740585
CLR
578.482344
CSRT
0.190190490475476
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号