SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO12397
Annotation
endonuclease-reverse_transcriptase_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 2.177
 

Sequence

CDS
ATGGGACTAGCAATTAACAAAAGCAAGATCAAGCTGCTAGTCGTAGACCGCTTCTCATCCATTCAGCGTACGGACCTTTTGGCAGAATACGAGGCCGTAGACCAGTTTGTCTACCTTGGTTCTGTGATCACGGATAAGGGGAGCTGTGAGCCTGAAATACGCCGACGTATTGGAATGGCTAAAACAGCTATGACGCAGTTGAGCAAAGTTTGGAAAGATCGTAATATTTCGAATAGGACCAAAATACATCTTGTGCAGTCACTGGTCTTTCCAATCGCTCTCTATGGAGCAGAAACATGGACCATAAAAGCAGCTGACCGAAACAGACTTGATGCTTTTGAAATGTGGTGCTGGCGCCGCCTATTAAGGGTTCCATGGACAGCCCACCGCACGAACATCTCGGTCCTACATCAGTTTAAAATGGAGAACGCTCAACGCCTGTCTGCCACCTGTCTGCAACTCATAATGCGCTACTTTGGCCACGTTGCCCGCAGAGGTGTAAACAACTTGGAACGTCTGATGGTCACTGGGAAAGTAGAAGGAAAACGTCCTAGAGGCTGGAGCCCCAAACGTTGGTCCGACCAGATCTCCGAGCAAACCAGCGGACCATTTAGCGCTGCACTACACCAGGCAACTAACCGGAACCGATGGAGGCTGACAGTCGACAAGCTAAAACGGAGTCACGATCCTCAGCAATGA
Protein
MGLAINKSKIKLLVVDRFSSIQRTDLLAEYEAVDQFVYLGSVITDKGSCEPEIRRRIGMAKTAMTQLSKVWKDRNISNRTKIHLVQSLVFPIALYGAETWTIKAADRNRLDAFEMWCWRRLLRVPWTAHRTNISVLHQFKMENAQRLSATCLQLIMRYFGHVARRGVNNLERLMVTGKVEGKRPRGWSPKRWSDQISEQTSGPFSAALHQATNRNRWRLTVDKLKRSHDPQQ

Summary

EMBL
FJ265548    ADI61816.1    FJ265557    ADI61825.1    FJ265546    ADI61814.1    + More
ODYU01004401    SOQ44236.1    FJ265553    ADI61821.1    RSAL01000289    RVE42931.1    KZ150203    PZC72267.1    FJ265547    ADI61815.1    FJ265560    ADI61828.1    FJ265552    ADI61820.1    GU815090    ADF18553.1    ODYU01003523    SOQ42419.1    ODYU01001007    SOQ36619.1    MRZV01002322    PIK33998.1    BDOT01000049    GCF48199.1    BDOT01000011    GCF43483.1    MRZV01000817    PIK43880.1    BDOT01000067    GCF49499.1    BDOT01000136    GCF52589.1    BDOT01000127    GCF52250.1    BDOT01000102    GCF51323.1    BDOT01000229    GCF55077.1    BDOT01000029    GCF46213.1    BDOT01000043    GCF47709.1    BDOT01000605    GCF59871.1    BDOT01000015    GCF44244.1    BDOT01000476    GCF58985.1    BDOT01000096    GCF51102.1    BDOT01002031    GCF43155.1    BDOT01000002    GCF40281.1    BDOT01000016    BDOT01001142    GCF44381.1    GCF61716.1    BDOT01000018    GCF44764.1    GCF52591.1    BDOT01000073    GCF49926.1    BDOT01000045    BDOT01000110    GCF47846.1    GCF51642.1    BDOT01000069    GCF49671.1    GCF44759.1    BDOT01000028    GCF46025.1    GCF44750.1    BDOT01000084    GCF50558.1    GCF44715.1    BDOT01000230    GCF55115.1    BDOT01000203    GCF54495.1    BDOT01000006    GCF41907.1    BDOT01000005    BDOT01000065    GCF41638.1    GCF49423.1    BDOT01000022    GCF45060.1    GCF49634.1    GCF41659.1    GCF41567.1    BDOT01000090    GCF50896.1    BDOT01000816    GCF60864.1    BDOT01000335    GCF57285.1    BDOT01000333    GCF57251.1    BDOT01000024    BDOT01000208    GCF45062.1    GCF45289.1    GCF54601.1    BDOT01000130    GCF52365.1    GCF44200.1    GCF41639.1    GCF41954.1    GCF57283.1    GCF40329.1    BDOT01000031    GCF46419.1    BDOT01000484    GCF59029.1    BDOT01000161    GCF53338.1    BDOT01000001    GCF39783.1    GCF46212.1    BDOT01000234    GCF55219.1    AHAT01022938    BDOT01000008    GCF42801.1    BDOT01000010    GCF43212.1    BDOT01000066    GCF49478.1    BDOT01000104    GCF51438.1    GCF49500.1    BDOT01000055    GCF48642.1    BDOT01000039    GCF47419.1    BDOT01000105    GCF51467.1    BDOT01000103    GCF51376.1    BDOT01000052    GCF48476.1    BDOT01000165    GCF53438.1    GCF44774.1    GCF43472.1    BDOT01000537    GCF59468.1    BDOT01000078    GCF50245.1    GCF43215.1    GCF41453.1    GCF44533.1    MRZV01001207    PIK39730.1    GCF51115.1    BDOT01000075    GCF50047.1    BDOT01000134    GCF52502.1    BDOT01000240    GCF55388.1    BDOT01000163    GCF53402.1    GCF40140.1    BDOT01000192    GCF54186.1    BDOT01000153    GCF53117.1    BDOT01000058    GCF48816.1    BDOT01000017    GCF44644.1    BDOT01000113    GCF51771.1    GCF47710.1    GCF41662.1    BDOT01000040    GCF47493.1   
Pfam
PF00078   RVT_1        + More
PF14529   Exo_endo_phos_2
Interpro
IPR036691   Endo/exonu/phosph_ase_sf        + More
IPR005135   Endo/exonuclease/phosphatase       
IPR000477   RT_dom       
IPR002138   Pept_C14_p10       
IPR039034   INPP4       
IPR035892   C2_domain_sf       
SUPFAM
SSF56219   SSF56219       
Gene 3D

Ontologies

Topology

Length:
232
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
1.16958
Exp number, first 60 AAs:
0.00019
Total prob of N-in:
0.12332
outside
1  -  232
 
 

Population Genetic Test Statistics

Pi
39.175881
Theta
106.584043
Tajima's D
-0.711902
CLR
0
CSRT
0.194490275486226
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号