SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO12326
Annotation
PREDICTED:_uncharacterized_protein_LOC106710892_[Papilio_machaon]
Full name
Retrovirus-related Pol polyprotein from transposon 17.6       + More
Retrovirus-related Pol polyprotein from transposon 297      
Location in the cell
Nuclear   Reliability : 2.612
 

Sequence

CDS
ATGAGGGAAAGTATCTCCCCTTGGTCGTGCCCGGTACACATTGTTCCGAAAAAACCGGATGCATCAGGAAAAGTTAAATGGAGACTTGTTATTGACTATAGAAGACTTAATGACAGAATTATAGAAGACAAGTACCCCTTACCAAACATTAACGACATCCTTGACAGATTAGGGCGCGCACAATATTTCACGACCATAGATTTAGCAAGCGGCTACCATCAATTAGAAATGCACCCTAAAGACGTAGAGAAAACAGCGTTTACTACTGAAAGAGGCCACTATGAGTTCCTAAGAATGCCTTTCGGACTAAAAAATGCCCCGAGCACTTTCCAGCGTCTTATGGACCATATACTCCGAGGTATAGACAACGTATTTACGTACTTAGATGACGTCATAATAGCGGCGACGTCCCTACAAAACCACAATGAAAAACTGAAATTAGTATTTCAGCGATTCAAAATGCATAATCTGAAAGTTCAGTTAGACAAATCAGAATTTCTACAGAAGCACGTTAACTTTCTAGGACATGAATTGACTGACCAAGGACTAAATCCTAACAAGGACAAAATTAAAGCAGTATTAAATTTCCCTATACCACAAACGCAAAAAGACATAAAAGCTTTCTTAGGACTAGTCGGGTACTATAGGAAGTTTATTAAGGACTTTGCGAAGTTGACGAAACCTTTAACAGCATGTCTAAAAAAGAACGCAAAGGTTGAACATACAAACGAATTTTTAGACGCAGTTGATAAATGCAAACAAATTCTAACAAACGCCCCAATCCTGCAATACCCTGACTTCGACAAACCGTTTATTTTAACGACAGACGCATCTGACTTTGCTTTAGGAGCAGTACTTTCCCAAGGCAATGTGGGCTCAGATAAACCAGTAGCCTATGCCTCAAGGACATTATCAGATACTGAGATCCGTTACTCTACCATAGAGAAAGAACTGTTAGGGATAGTATGGGCAATTAAGTATTTTAGACCTTACTTATATGGCCGTAAATTTACAATTTATACGGACCATAGACCCCTTACATGGTTAATGAGTCTAAAGGACCCTAACTCTAAATTAACACGATGGAAACTAAAGTTAGCAGAGTATGATTACAAAGTTGTTTATAAAAAGGGCAAACAAAACACTAACGCAGATGCACTATCTCGAGCAAAAATTTTTCATAATAGTATAGACTCTCTAGCTGTTAATGTTGATGACAATAGTGATGAAAACATAATAAACAGAATATTCGAAAACGCCCGGAGACAGGCAGAGATAGAAACTAATGACCCGAATAACCAAGACAATGAACGTAACAATACTGACAATAACGACCAACCTTATAACAATAATGACGTAGAAATGACCAGTATCTATCCCTCTCAAATTGACGAAGAGACAGACACAAGGAGTGCAACAACAGTCGACCCCGATCAATTAGTTTCTACAAATCATACCCAACCTGATAATGAAAATAACGGTATCCCTATAATATCCGACGCTATTGATAGACAGTTGAAACAATTTTACGTTAGGTCCACACCAGGTTCTACATACAGAGTAGAGGACAGATCAACAAACTCTAGGACATTCAAAGGTTCATTAATCAATGCGACCTTTGCCTAA
Protein
MRESISPWSCPVHIVPKKPDASGKVKWRLVIDYRRLNDRIIEDKYPLPNINDILDRLGRAQYFTTIDLASGYHQLEMHPKDVEKTAFTTERGHYEFLRMPFGLKNAPSTFQRLMDHILRGIDNVFTYLDDVIIAATSLQNHNEKLKLVFQRFKMHNLKVQLDKSEFLQKHVNFLGHELTDQGLNPNKDKIKAVLNFPIPQTQKDIKAFLGLVGYYRKFIKDFAKLTKPLTACLKKNAKVEHTNEFLDAVDKCKQILTNAPILQYPDFDKPFILTTDASDFALGAVLSQGNVGSDKPVAYASRTLSDTEIRYSTIEKELLGIVWAIKYFRPYLYGRKFTIYTDHRPLTWLMSLKDPNSKLTRWKLKLAEYDYKVVYKKGKQNTNADALSRAKIFHNSIDSLAVNVDDNSDENIINRIFENARRQAEIETNDPNNQDNERNNTDNNDQPYNNNDVEMTSIYPSQIDEETDTRSATTVDPDQLVSTNHTQPDNENNGIPIISDAIDRQLKQFYVRSTPGSTYRVEDRSTNSRTFKGSLINATFA

Summary

Catalytic Activity
a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1)
Miscellaneous
The open reading frame is located in a copia-like transposable element called 17.6.
Keywords
Aspartyl protease   Endonuclease   Hydrolase   Nuclease   Nucleotidyltransferase   Protease   RNA-directed DNA polymerase   Transferase   Transposable element  
Feature
chain  Retrovirus-related Pol polyprotein from transposon 17.6
EMBL
GALX01004629    JAB63837.1    M32662    AAA92249.1    DS497745    EFA13136.1    + More
GEZM01078735    JAV62639.1    GEDC01017847    GEDC01011974    JAS19451.1    JAS25324.1    GEDC01002915    JAS34383.1    GFTR01008505    JAW07921.1    GALX01005891    JAB62575.1    GEHC01000961    JAV46684.1    DS235852    EEB18765.1    GALX01005230    JAB63236.1    EEB18763.1    AJ000387    CAA04050.1    AY928610    AAX28844.1    GBHO01024992    JAG18612.1    GEZM01081533    JAV61609.1    GBHO01024993    JAG18611.1    GDHC01021754    JAP96874.1    GFTR01008672    JAW07754.1    GEHC01000905    JAV46740.1    GANO01002504    JAB57367.1    GBRD01016627    JAG49199.1    GBHO01012506    JAG31098.1    GDHC01015253    JAQ03376.1    GEHC01000906    JAV46739.1    GG694348    EFA13518.1    GDHF01002622    JAI49692.1    GBBI01004048    JAC14664.1    GBBI01004049    JAC14663.1    GGMR01005970    MBY18589.1    GDHF01004109    JAI48205.1    GBBI01004051    JAC14661.1    GFTR01008492    JAW07934.1    NEVH01026087    PNF14896.1    GFTR01008667    JAW07759.1    NEVH01002988    PNF41072.1    GBHO01026285    JAG17319.1    GBHO01007885    JAG35719.1    GGMR01005468    MBY18087.1    NEVH01009425    PNF32982.1    GFXV01006571    MBW18376.1    GDHC01013046    JAQ05583.1    GBBI01004233    JAC14479.1    LBMM01013045    KMQ85846.1    NEVH01005888    PNF38366.1    GGMR01006290    MBY18909.1    ABLF02041284    LBMM01008064    KMQ89174.1    GGMR01003444    MBY16063.1    Z24451    CAA80824.1    NEVH01019964    PNF22169.1    NEVH01022642    PNF18384.1    X01472    NEVH01025646    PNF15218.1    LBMM01008712    KMQ88680.1    AF364550    AAK52058.1    NEVH01006666    PNF37360.1    X03431    ABLF02024213    ABLF02042472    AF492764    AAM11674.1    GDAI01000740    JAI16863.1    GGMS01012487    MBY81690.1    GBBI01004050    JAC14662.1    NEVH01023280    PNF18074.1    ABLF02041728    AJ009736    CAA08807.1    GBBI01004444    JAC14268.1    NEVH01011195    PNF31840.1    ABLF02001345    ABLF02006651    ABLF02006655    ABLF02054079    ABLF02054906    ABLF02062695    AF541948    AAN34651.1    GGMR01014274    MBY26893.1    GDAI01000738    JAI16865.1    LBMM01007099    KMQ90041.1    NEVH01000607    PNF43410.1    DNYX01000282    HBK83635.1    GBXI01013483    JAD00809.1    GBBI01004677    JAC14035.1    ABLF02030471    ABLF02066562    NEVH01026392    PNF14303.1    NEVH01021952    PNF19057.1    GDHF01005932    JAI46382.1    GEHC01000875    JAV46770.1    GALA01001779    JAA93073.1    ABLF02011176    ABLF02041729    AF056940    AAC33318.1    ABLF02011604    ABLF02041632    DNYX01000239    HBK83403.1    GGMR01012631    MBY25250.1    ABLF02041376   
Pfam
PF00078   RVT_1        + More
PF17921   Integrase_H2C2
PF17917   RT_RNaseH
PF00665   rve
PF17919   RT_RNaseH_2
PF02902   Peptidase_C48
PF00077   RVP
PF01661   Macro
PF12259   Baculo_F
PF00098   zf-CCHC
Interpro
IPR000477   RT_dom        + More
IPR012337   RNaseH-like_sf       
IPR041373   RT_RNaseH       
IPR036397   RNaseH_sf       
IPR041588   Integrase_H2C2       
IPR001584   Integrase_cat-core       
IPR001969   Aspartic_peptidase_AS       
IPR021109   Peptidase_aspartic_dom_sf       
IPR041577   RT_RNaseH_2       
IPR003653   Peptidase_C48_C       
IPR038765   Papain-like_cys_pep_sf       
IPR001995   Peptidase_A2_cat       
IPR002589   Macro_dom       
IPR018061   Retropepsins       
IPR036875   Znf_CCHC_sf       
IPR001878   Znf_CCHC       
IPR022048   Envelope_fusion-like       
SUPFAM
SSF53098   SSF53098        + More
SSF50630   SSF50630       
SSF54001   SSF54001       
SSF57756   SSF57756       
Gene 3D
PDB
4OL8     E-value=9.18711e-74,     Score=705

Ontologies

Topology

Length:
541
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00312
Exp number, first 60 AAs:
0
Total prob of N-in:
0.00142
outside
1  -  541
 
 

Population Genetic Test Statistics

Pi
1.085972
Theta
2.525181
Tajima's D
-1.41134
CLR
51.668666
CSRT
0.0632968351582421
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号