SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO12145
Annotation
PREDICTED:_uncharacterized_protein_LOC103309185_[Acyrthosiphon_pisum]
Full name
ATP-dependent DNA helicase      
Location in the cell
Mitochondrial   Reliability : 1.266 Nuclear   Reliability : 1.295
 

Sequence

CDS
ATGTTTGCTAAAGTTGAAAGCGAACGCTTGCGATTCATTCGACATAACCAGGCTAAATTACGATCGGAAGAATATATTCACTTACGAGATGCTGTTGCTGGAAACATCAACGGAAATTTAAATCTCAATGACATCGGTAATGCTTTCATTTTACCTTCAAGCTACATCGGCAGTCCACGGAACATGCAGGAATACATACAAGATGCGATGACTTGTCGATATCAAGAAAGATATTAA
Protein
MFAKVESERLRFIRHNQAKLRSEEYIHLRDAVAGNINGNLNLNDIGNAFILPSSYIGSPRNMQEYIQDAMTCRYQERY

Summary

Catalytic Activity
ATP + H2O = ADP + H(+) + phosphate
Cofactor
Mg(2+)
Similarity
Belongs to the helicase family.
EC Number
3.6.4.12
EMBL
GGMS01010456    MBY79659.1    RSAL01000037    RVE51179.1    GEDC01027363    JAS09935.1    + More
RSAL01000340    RVE42412.1    GAMC01021199    JAB85356.1    APCN01007923    ABLF02018127    ABLF02032513    ABLF02032521    UYRW01018412    VDN05143.1    UYRW01018272    VDN04965.1    GDHF01025166    JAI27148.1    RSAL01000011    RVE53580.1    GAIX01013838    JAA78722.1    HQ009558    AEE09607.1    GDHF01015751    JAI36563.1    GDHF01004446    JAI47868.1    GAKP01008635    JAC50317.1    GGMS01009532    MBY78735.1    UYRW01014111    VDN00656.1    RSAL01000635    RVE41284.1    ABLF02016067    ABLF02055484    ABLF02017698    ABLF02017702    UYRW01009976    VDM98357.1    GDHF01013973    JAI38341.1    KN747262    KIH51216.1    HACG01044765    CEK91630.1    ABLF02054239    KN739098    KIH54433.1    KN727000    KIH66715.1    KN782863    KIH43787.1    ABLF02006716    ABLF02036458    KN793733    KIH42687.1    ABLF02021131    ABLF02042289    UYRW01000259    VDK65087.1    ABLF02041880    ABLF02048363    KN769739    KIH46246.1    KE125664    EPB67478.1    JOJR01000205    RCN42227.1    JARK01001590    EYB87952.1    KE125416    EPB68565.1    ABLF02017703    ABLF02041883    NIVC01000366    PAA84583.1    NIVC01001445    PAA67902.1    NIVC01000229    PAA87485.1    NIVC01000111    PAA90396.1    RSAL01001639    RVE40746.1    GL443063    EFN62624.1    NIVC01000900    PAA75136.1    NIVC01001359    PAA68995.1    KN774203    KIH45048.1    NIVC01001486    PAA67379.1    JARK01000714    EYC35207.1    KE126587    EPB66060.1    KN784566    KIH43583.1    KN764510    KIH47919.1    JOJR01000041    RCN48933.1    GECZ01005881    JAS63888.1    KN730120    KIH61445.1    JARK01001428    EYC03674.1    EYC03673.1    KN740416    KIH53763.1    KN775499    KIH44795.1    KN780391    KIH44087.1    KN740537    KIH53717.1    JARK01001339    EYC32590.1    KN768331    KIH46904.1    KN739487    KIH54222.1    ABLF02006224    ABLF02066369    KN743176    KIH52626.1    NIVC01002773    PAA55312.1    ABLF02039418    ABLF02041882    KN730521    KIH60924.1    ABLF02015086    KN786242    KIH43391.1    KN736527    KIH55919.1    GDHF01015170    JAI37144.1    UYRW01017020    VDN03878.1    KN761288    KIH48241.1    GL444143    EFN61253.1    UZAJ01008183    VDO52160.1    KN784365    KIH43605.1    KN726282    KIH68828.1    KN783117    KIH43754.1    KN767628    KIH47497.1    UYRW01002810    VDK86817.1    UYRW01000991    VDK72957.1    GAKP01000461    JAC58491.1    HACG01044764    CEK91629.1    ABLF02004918    JOJR01000111    RCN45090.1    ODYU01007016    SOQ49380.1    LBMM01013912    KMQ85421.1    ABLF02016597    KQ415875    KOF99875.1   
Pfam
PF14214   Helitron_like_N        + More
PF05970   PIF1
Interpro
IPR025476   Helitron_helicase-like        + More
IPR027417   P-loop_NTPase       
IPR010285   DNA_helicase_pif1-like       
IPR038765   Papain-like_cys_pep_sf       
IPR003323   OTU_dom       
SUPFAM
SSF52540   SSF52540        + More
SSF54001   SSF54001       

Ontologies

Topology

Length:
78
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.02052
Exp number, first 60 AAs:
0.02025
Total prob of N-in:
0.33543
outside
1  -  78
 
 

Population Genetic Test Statistics

Pi
177.399956
Theta
143.468619
Tajima's D
0.664904
CLR
0.236164
CSRT
0.566171691415429
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号