SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO12137
Pre Gene Modal
BGIBMGA004253
Annotation
PREDICTED:_uncharacterized_protein_LOC105841792_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 2.06
 

Sequence

CDS
ATGGAACAAAAACATATTCCTCAAGAGCAAGCTGGATTCCGTCCAGGACGCAGCTGCAGCGATCAAGTGTTAGCACTGACCACACTCTTGGAGAGGGGCTTTAACGAAAACCTCAAGTCGTCAACTGTATTCGTGGATCTAACAGCTGCTTACGACACTGTGGCGCCAGGGACTGCTGTACAAACTACTCAAGCTGATCCCCTGTATATAAAGATCTACAATGTTATTGAGGACGCCCTTACCAACAGACCATTCCGTGTCCATCTGGGAGACAATTCTAGCTTATCCAGGGTCCTGAACAACGGCCTCCCGCAGGGTTCAGTCCTCGCACCAACACTCTTCAACGTGTACACCCACGATGTGCCAGAGACGCTCTCCAGGAAATTTGCGTACGCCGACGATCTAGCTCTAGTCGCACAAGGCCGCAGTTCTAAGGCGTGGTCAGATGGATCATCAAAGGGGCTTAAAAAACCAATTTCGAAAGGACAAAGGATTGTGATAGTGCACGCTGGATCCGAAGTTGGCTTTGTTCCTAATGCGCTGCTCTTATTTAAAGCGGGAACAAAATCTGGCGACTTTCATGATAACATGAATTATGAAAATTATACCAAGTGGCTTCGCAGCGAACTTATACCTAACCTGCCGCCAAATGCTGTATTAGTAATCGATAACGCATCATACCACAACAAACAGTACGATCCTGCACCTACCTCGAATGCCAAGAAAGCAGATATGCAGAGGTGGTTGGCGGAAAAGGACATACCATACGAAGAGAGTATGCTCAAACCTCAGCTACACAAATTGATTAGACTGTATAAATAA
Protein
MEQKHIPQEQAGFRPGRSCSDQVLALTTLLERGFNENLKSSTVFVDLTAAYDTVAPGTAVQTTQADPLYIKIYNVIEDALTNRPFRVHLGDNSSLSRVLNNGLPQGSVLAPTLFNVYTHDVPETLSRKFAYADDLALVAQGRSSKAWSDGSSKGLKKPISKGQRIVIVHAGSEVGFVPNALLLFKAGTKSGDFHDNMNYENYTKWLRSELIPNLPPNAVLVIDNASYHNKQYDPAPTSNAKKADMQRWLAEKDIPYEESMLKPQLHKLIRLYK

Summary

Uniprot
ProteinModelPortal
PDB
6AR3     E-value=0.0176193,     Score=87

Ontologies

GO

Topology

Length:
273
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.677299999999999
Exp number, first 60 AAs:
0.00324
Total prob of N-in:
0.10398
outside
1  -  273
 
 

Population Genetic Test Statistics

Pi
274.6165
Theta
183.018291
Tajima's D
0.935288
CLR
0
CSRT
0.649217539123044
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号