SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO12131
Annotation
PREDICTED:_LOW_QUALITY_PROTEIN:_uncharacterized_protein_LOC105841899?_partial_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 2.268
 

Sequence

CDS
ATGGTTGCCGAACCTCCCCTCCCCGGGCTGAGCGTAATTTGTTACGCCGACGATACGTTGGTCGTGGCTCCGGGGAGGGACTACCGGGAGTCTGCCCGTCTGGCGTGCGCAGGCGTGGCACACGTCGTCACAAGGATCCGACGGTTGGGGCTCGAGGTGGCGCTCGACAAAACCCAGGCCCTGTTGTTTCACGGGCCGGGACGAGCGCCGCCTCTGGGTGCCCACCTTGTGATCGGAGGCGTCCGCGTCGGGGTCGGGGTGACCGGTCTTCGGTACCTCGGCCTCGAACTGGATGGTCGGTGGAACTTCTGCGCTCACTTTGAGAAGTTGGGCCCTCGACTGATGGCGACGGTCGGCTCTTTGAGCCGGCTGCTTCCAAACGTTGGGGGTCCCGATCAGGTGGCGCGCCGCCTCTACATGGGGGTGGTGCGGTCGATGGCACTATACGGGGCTCCCGTATGGTCCCACGTCCTGACCCGCAAGAATGTCGCGGCGCTGCGGCGTCCGCAGTGCGCGATCGCGGTCAGGGCGATCCGAGGATACCGCACCGTCTCCTTCGAGGCGGCGTGCTTGCTCGCCGGGGCGCCACCCTGGGACCTGGAGGCGGAGGCGCTCGCTGCCGATTACCGGTGGCGTAGCGACCTTCGCTCTAGGGGGGAAGGACGCCCCGGCGAAGAAGTAGTTCGAGCGCGGAGGCTCCAATCTCGGCGGTCCGTGCTGGAGGCGTGGTCTCGCCGCTTGGCGGACCCGTCTGCCGGCCTCCGTACCGTCGAGGCGGTCCGCCCGGTTCCCGCGGACTGGGTGGGCCGCGACCGCGGATGCTTCACCTTCCGGCTGACGCAGATGTTGACCGACCATGGGTGTTTTGGCCGGTACCTCTTTAAGATAGCCGGAAGGGAACCGACGGCGCAGTGCCACCACTGCGCGGACCGCGACGAGGAAGACACAGCGGAACACACATTGGCGCGTTGCTCTGGATTCGACGAGCAACGCGCCGCCCTCGTCGCGGTCATAGGAGAGGACCTCTACCCGAAAAAAAAAAGGGTGCCGAACTTCCTACGAGGTCTCCGCGCAAAAGGGGCGCGCGGTGCATGGTGTTGTGAGCAGACCGCGGGCCCAAGGATTTTAGGGCCCACCCACTAA
Protein
MVAEPPLPGLSVICYADDTLVVAPGRDYRESARLACAGVAHVVTRIRRLGLEVALDKTQALLFHGPGRAPPLGAHLVIGGVRVGVGVTGLRYLGLELDGRWNFCAHFEKLGPRLMATVGSLSRLLPNVGGPDQVARRLYMGVVRSMALYGAPVWSHVLTRKNVAALRRPQCAIAVRAIRGYRTVSFEAACLLAGAPPWDLEAEALAADYRWRSDLRSRGEGRPGEEVVRARRLQSRRSVLEAWSRRLADPSAGLRTVEAVRPVPADWVGRDRGCFTFRLTQMLTDHGCFGRYLFKIAGREPTAQCHHCADRDEEDTAEHTLARCSGFDEQRAALVAVIGEDLYPKKKRVPNFLRGLRAKGARGAWCCEQTAGPRILGPTH

Summary

EMBL
AB090825    BAC57926.1    KZ150386    PZC71062.1    AB078931    BAC06456.1    + More
AB078930    BAC06454.1    AB078929    BAC06452.1    AB078935    BAC06462.1    RSAL01000481    RVE41577.1    KZ149896    PZC78733.1    LBMM01012027    KMQ86470.1    KZ150308    PZC71477.1    D85594    BAA19776.1    LBMM01024882    KMQ82501.1    KQ460685    KPJ12887.1    LBMM01014132    KMQ85305.1    LBMM01024063    KMQ82623.1    LBMM01008861    KMQ88580.1    LBMM01009738    KMQ87908.1    LBMM01019839    KMQ83438.1    LBMM01006954    KMQ90166.1    LBMM01006063    KMQ90967.1    LBMM01019838    KMQ83439.1    LBMM01006725    KMQ90373.1    LBMM01006671    KMQ90407.1    LBMM01006657    KMQ90417.1    QOIP01000010    RLU18098.1    LBMM01007036    KMQ90099.1    LBMM01004272    KMQ92618.1    LBMM01008448    KMQ88867.1    LBMM01002052    KMQ95336.1    LBMM01005707    KMQ91279.1    LBMM01005733    KMQ91252.1    LBMM01013668    KMQ85535.1    LBMM01014956    KMQ84982.1    LBMM01008682    KMQ88705.1    LBMM01015018    KMQ84954.1    LBMM01007425    KMQ89740.1    LBMM01015025    KMQ84953.1    LBMM01004634    KMQ92224.1    QOIP01000031    RLU14697.1    LBMM01007659    KMQ89538.1    LBMM01012412    KMQ86235.1    LBMM01008278    KMQ89009.1    LBMM01003988    KMQ92922.1    LBMM01006496    KMQ90570.1    LBMM01003245    KMQ93755.1    LBMM01005216    KMQ91703.1    LBMM01004697    KMQ92167.1    LBMM01004505    KMQ92346.1    LBMM01002480    KMQ94776.1    KMQ94772.1    LBMM01021647    KMQ83033.1    RSAL01003504    RVE40273.1    GL450953    EFN80213.1    LBMM01008349    KMQ88951.1    LBMM01014122    KMQ85315.1    GGMR01000779    MBY13398.1    LBMM01005465    KMQ91492.1    LBMM01005948    KMQ91066.1    LBMM01008422    KMQ88894.1    LBMM01005474    KMQ91485.1    ABLF02016099    ABLF02041594    LBMM01012595    KMQ86127.1    LBMM01009527    LBMM01009515    KMQ88059.1    KMQ88067.1    LBMM01003575    KMQ93366.1    ABLF02011927    GECU01032129    JAS75577.1    KQ971864    EFA13315.2    ABLF02004674    ABLF02004675    ABLF02004676    ABLF02011637    GGMR01012748    MBY25367.1    GGMS01012744    MBY81947.1    LBMM01006662    KMQ90413.1    KU543683    AMS38371.1    KQ971309    EEZ99146.1    KQ972226    KYB24577.1    ABLF02005203    ABLF02041316    GGMR01015354    MBY27973.1    GGMR01014195    MBY26814.1    GGMR01015159    MBY27778.1   
Pfam
PF14529   Exo_endo_phos_2        + More
PF00078   RVT_1
PF07776   zf-AD
PF00096   zf-C2H2
PF01553   Acyltransferase
PF03372   Exo_endo_phos
PF01421   Reprolysin
PF00098   zf-CCHC
Interpro
IPR000477   RT_dom        + More
IPR036691   Endo/exonu/phosph_ase_sf       
IPR005135   Endo/exonuclease/phosphatase       
IPR012934   Znf_AD       
IPR013087   Znf_C2H2_type       
IPR036236   Znf_C2H2_sf       
IPR002123   Plipid/glycerol_acylTrfase       
IPR001878   Znf_CCHC       
IPR036875   Znf_CCHC_sf       
IPR024079   MetalloPept_cat_dom_sf       
IPR001590   Peptidase_M12B       
SUPFAM
SSF56219   SSF56219        + More
SSF57667   SSF57667       
SSF57756   SSF57756       
Gene 3D

Ontologies

Topology

Length:
380
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.34353
Exp number, first 60 AAs:
0.00186
Total prob of N-in:
0.00115
outside
1  -  380
 
 

Population Genetic Test Statistics

Pi
0.701757
Theta
2.442516
Tajima's D
-1.68131
CLR
1381.328788
CSRT
0.0306984650767462
Interpretation
Possibly Positive selection

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号