SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO12062
Annotation
PREDICTED:_uncharacterized_protein_LOC106716864_[Papilio_machaon]
Location in the cell
Mitochondrial   Reliability : 1.113
 

Sequence

CDS
ATGCTCCAGTGGGAGATGGGTCGGTGGATCTGTCCTCAGATGAGGAAGGCTTGCTGCCCCCCAAGAAATTACCGACCACGAGGAGAGGTCGGCAGGCTTCGAGAGGAGGTCGCCAAGGCGGCCTCAGCAGCAACGCATGCCCCCGGCCAAACCGCAAAGGCGGTTGCGCAGCCTGCGCGGCGGGCTGCCAAAGGCGGTCGCAAAGGACCGGCGATACGTGCTCCGCGTTCCGAAGCTGTGACGCTCACGCTACAGCTCGGAGCTGCGGAGCGCGGCGTAACGTACCAGTCGGTCATCGCCGAAGCAAAGGCCAAGATCAAATTATCAGATCTTGGTCTTCAGGCCGTCACCCACAGGCAGGCTGCCACGGGTGCTCGGTTGTTCGAGGTGGCTGGTACTACGAGTGGCAGTGCCGAAAAGGCGGACGCTCTGGCCGCCAAGATGAGGGAGGTCCTCAGCCCCGAGGACGTCCGGGTCTCCAGGCCAATGAAAACTGCAGAGGTGCGGATTGCTGGCCTGGATGACTCCGTGACCTCTGAGGAGGTGGTAGCGGCCGTTGCCCGAAGTGGAGAGTGTCCATCGGACAAGGTGCGGGCCGGCGATATACGCACCGACGCCACCGGACTCGGCGTGGTCTGGGTTCGGTGCCCTGTAGCGTCGGCGAAAAAGATCGCCTTAAGCGGCAGATTGCTGTCTACTTACAAATTAACAGTATAA
Protein
MLQWEMGRWICPQMRKACCPPRNYRPRGEVGRLREEVAKAASAATHAPGQTAKAVAQPARRAAKGGRKGPAIRAPRSEAVTLTLQLGAAERGVTYQSVIAEAKAKIKLSDLGLQAVTHRQAATGARLFEVAGTTSGSAEKADALAAKMREVLSPEDVRVSRPMKTAEVRIAGLDDSVTSEEVVAAVARSGECPSDKVRAGDIRTDATGLGVVWVRCPVASAKKIALSGRLLSTYKLTV

Summary

Pfam
PF00098   zf-CCHC
Interpro
IPR036875   Znf_CCHC_sf        + More
IPR001878   Znf_CCHC       
SUPFAM
SSF57756   SSF57756       

Ontologies

Topology

Length:
238
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00455
Exp number, first 60 AAs:
0
Total prob of N-in:
0.05334
outside
1  -  238
 
 

Population Genetic Test Statistics

Pi
390.311179
Theta
33.087845
Tajima's D
2.11373
CLR
0
CSRT
0.903654817259137
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号